KEGG   Xenopus tropicalis (western clawed frog): 394954Help
Entry
394954            CDS       T01011                                 

Gene name
pdia3, erp57
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    394954 (pdia3)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     394954 (pdia3)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   394954 (pdia3)
  Exosomal proteins of colorectal cancer cells
   394954 (pdia3)
  Exosomal proteins of bladder cancer cells
   394954 (pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 501 aa AA seqDB search
MNRQLLGAFFLLAVTAGTQAAGSDVLDLTDDNFESTVSQHSILLVEFFAPWCGHCKKLAP
EYEIAATKLKGTLSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIV
STMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFA
HTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNIFGLC
PHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANR
KAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRY
MKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLG
DDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEGGREVSDFLSYLKKEA
TNPPVVKEDEKPKKKKKKEEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcaactcctcggcgccttcttcctcctggctgtcaccgccggcactcaggcc
gcaggttcagacgtcctggatctcactgacgataactttgaaagcaccgtgtctcagcac
agcatcctgctagtggagttcttcgctccctggtgtgggcattgtaagaagttagcacct
gaatatgagattgccgcaaccaagcttaaagggacactttccctggctaaggttgactgc
acagcaaattccaacacttgcaacaaatatggagtcagtggataccctactctaaaaata
ttcagagatggagaggattctggatcttatgatgggccaagaactgctgatggaattgtc
agtactatgaagaaacaagctggcccagcatctgtagatctccgatctgtaggcgaattt
gaaaaattcatttccgataaagatgcttctgtggtgggatttttccgggacttgtatagt
ggccctcactcagagtttcttaaagctgccaatacccttagggacaactatcgttttgct
cacacagatgaaaaagagcttgtggacaaatatgattcaaatggagaaggttttgtcttg
ttccgtccacaacatctggcaaacaaatttgaagatagctctgtgactttccctgctgat
gagaaaattaccagcagcaaaattaaaaaattcattcaagataacattttcggtctttgc
cctcatttgacagaagacaacaaagatttgattcaaggaaaggacttgcttgtggcatat
tatgacgttgactatgaaaagaatgtcaagggtaccaattattggcgaaacagagtcatg
aaggttgcaaagtcattcgttgatgctggcaaaaagcttaattttgccgttgctaacagg
aaagcctttggacatgaagtgacagaatttggtttagatgccggtactggggaacttcct
gttgttggaatcaaaactgctaagggggagaaatatgccatgcaagaagaattctcccgt
gatgggaaagctttggaaagattccttcaggattatttcgatggtaaactgaagagatac
atgaaatctgaagccatcccagaaagtaatgacggccctgttaaggtggtggtagctgaa
aactttgatgaaattgtaaacgatgacagcaaagatgtgctaattgagttctacgctcca
tggtgtggccattgtaagaacttggagcctaaatacaaagaacttggagagaagcttggt
gatgatccaaacattgtgattgccaagatggatgccacagcaaatgatgtgccatcccag
tatgaagttcgaggattccccacaatttactttactcctgcaggaagtaagcaaaaacca
aagagatatgagggtgggcgagaggtgagtgacttcctcagctatctgaagaaggaggca
acaaatcctccagtcgttaaggaagatgaaaaacccaaaaagaagaagaagaaggaagag
ttgtaa

DBGET integrated database retrieval system