KEGG   Xenopus tropicalis (western clawed frog): 394954Help
Entry
394954            CDS       T01011                                 

Gene name
pdia3, erp57
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xtr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 501 aa AA seqDB search
MNRQLLGAFFLLAVTAGTQAAGSDVLDLTDDNFESTVSQHSILLVEFFAPWCGHCKKLAP
EYEIAATKLKGTLSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIV
STMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFA
HTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNIFGLC
PHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANR
KAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRY
MKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLG
DDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEGGREVSDFLSYLKKEA
TNPPVVKEDEKPKKKKKKEEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcaactcctcggcgccttcttcctcctggctgtcaccgccggcactcaggcc
gcaggttcagacgtcctggatctcactgacgataactttgaaagcaccgtgtctcagcac
agcatcctgctagtggagttcttcgctccctggtgtgggcattgtaagaagttagcacct
gaatatgagattgccgcaaccaagcttaaagggacactttccctggctaaggttgactgc
acagcaaattccaacacttgcaacaaatatggagtcagtggataccctactctaaaaata
ttcagagatggagaggattctggatcttatgatgggccaagaactgctgatggaattgtc
agtactatgaagaaacaagctggcccagcatctgtagatctccgatctgtaggcgaattt
gaaaaattcatttccgataaagatgcttctgtggtgggatttttccgggacttgtatagt
ggccctcactcagagtttcttaaagctgccaatacccttagggacaactatcgttttgct
cacacagatgaaaaagagcttgtggacaaatatgattcaaatggagaaggttttgtcttg
ttccgtccacaacatctggcaaacaaatttgaagatagctctgtgactttccctgctgat
gagaaaattaccagcagcaaaattaaaaaattcattcaagataacattttcggtctttgc
cctcatttgacagaagacaacaaagatttgattcaaggaaaggacttgcttgtggcatat
tatgacgttgactatgaaaagaatgtcaagggtaccaattattggcgaaacagagtcatg
aaggttgcaaagtcattcgttgatgctggcaaaaagcttaattttgccgttgctaacagg
aaagcctttggacatgaagtgacagaatttggtttagatgccggtactggggaacttcct
gttgttggaatcaaaactgctaagggggagaaatatgccatgcaagaagaattctcccgt
gatgggaaagctttggaaagattccttcaggattatttcgatggtaaactgaagagatac
atgaaatctgaagccatcccagaaagtaatgacggccctgttaaggtggtggtagctgaa
aactttgatgaaattgtaaacgatgacagcaaagatgtgctaattgagttctacgctcca
tggtgtggccattgtaagaacttggagcctaaatacaaagaacttggagagaagcttggt
gatgatccaaacattgtgattgccaagatggatgccacagcaaatgatgtgccatcccag
tatgaagttcgaggattccccacaatttactttactcctgcaggaagtaagcaaaaacca
aagagatatgagggtgggcgagaggtgagtgacttcctcagctatctgaagaaggaggca
acaaatcctccagtcgttaaggaagatgaaaaacccaaaaagaagaagaagaaggaagag
ttgtaa

DBGET integrated database retrieval system