KEGG   Xenopus tropicalis (western clawed frog): 394964Help
Entry
394964            CDS       T01011                                 

Gene name
guk1, gmk
Definition
guanylate kinase 1 (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    394964 (guk1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     394964 (guk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 213 aa AA seqDB search
MISSWSKVFRVTAAGMAGPRPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRP
GEADGKDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQ
GVKSIKKTSLNPIYISIHPPSVPILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLF
DAIIVNDDLEEAYAHLKGTLAQEIKQAQSSKNS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagctggagtaaggtcttccgggtaacggctgcaggtatggctgggcccagg
ccagtggtgctgagcggcccctccggggcggggaaaagcaccctcctcaagcgactcatg
aacgaatatgaagggctgtttggcttttcagtttctcataccacgagaaagccccgccct
ggggaggctgatgggaaagattaccattttgtgagtctggacgacatgaagaagggaata
gagagaggggagtttatagaacatgcagtgttttctgggaacatgtacgggaccagtacc
gccgccgtgcaggccgtccaggccaggaaccagatctgtatactggatatcgacatgcag
ggagtgaagagcataaagaagaccagtctgaatcccatttacatctccattcacccaccg
tcagttccaatattagagaagcggttacgagacagaaacacagagtcggaggaaagttta
cagaaaagactgaacgcagcaatagccgacctggagatcagcaaagagcctggtctgttt
gatgccattattgtcaatgatgatttagaagaggcctacgctcatctgaagggaaccctg
gcacaagagatcaaacaagcccagagcagcaagaattcctga

DBGET integrated database retrieval system