KEGG   Xenopus tropicalis (western clawed frog): 394980Help
Entry
394980            CDS       T01011                                 

Gene name
sirt6, sir2l6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     394980 (sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 331 aa AA seqDB search
MSVNYAAGLSPYSDKGRCGLPEAFDPPDELCRKVVELADMIRKSSYVVFHTGAGISTSCG
IPDFRGPNGVWTLEEKGVNPKFDITFESACPSPTHMALLQLQRVGILKFLVSQNVDGLHV
RSGFPREQLAELHGNMFVEECSKCSKQYVRDQVVGTMGLKPTGRLCDVPKVRGLRACRGK
LKDTILDWEDSLPDRDLNLADEACRKADLSITLGTSLQIRPSGNLPLLTKRKGGKLVIVN
LQPTKHDKHADLRIHGYVDEVMTQLMELLGHKIPVWTGMPTKTEPTNGNYKEENHFYNDS
VLGANPNQKREGCKEEPNLEPKKAKVEPACV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattatgcggctggcctgtctccctattccgataagggacgatgtgggctc
ccggaggcatttgatccaccggacgaactgtgtcgcaaggtagtggaactagctgatatg
attcggaaatcctcctacgtagtatttcacacgggagccgggatcagtacttcctgcgga
atcccagatttcagggggcctaatggagtgtggactctggaggagaaaggtgtgaaccca
aagtttgacatcacgtttgaatctgcatgtccttcccctacccacatggcgctgcttcag
ctgcagagggttggcatcctgaaatttttggttagccaaaacgtagatggcttgcatgta
agatctggcttccccagagagcagctggcagaactacatggaaacatgttcgtggaggaa
tgcagcaaatgtagcaaacagtacgtgcgagatcaagttgtaggaaccatggggctcaaa
cctactgggagactctgtgatgtgcccaaggtgcgaggcctgagagcttgcagggggaag
ctcaaagacaccattttggattgggaagactcacttcctgacagagacctaaacctagcc
gatgaagcctgcaggaaagcagacctgtccattacattggggacatcactgcagattaga
cccagtgggaacctaccactcctcaccaagcgcaagggtgggaaactagttattgtaaac
cttcagccgaccaagcatgacaagcacgcggatttgagaatacacggttatgtggatgaa
gtgatgacacagctcatggagcttttgggtcacaagataccagtttggactggtatgcct
actaaaacagagccaactaatggaaactataaggaggaaaatcatttctacaatgattca
gtgctgggtgctaacccaaaccaaaaaagagaaggatgcaaggaagaacctaatctcgag
ccaaaaaaggcaaaagttgagccagcatgtgtatga

DBGET integrated database retrieval system