KEGG   Xenopus tropicalis (western clawed frog): 395037Help
Entry
395037            CDS       T01011                                 

Gene name
ppp3r1
Definition
protein phosphatase 3, regulatory subunit B, alpha (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395037 (ppp3r1)
   04310 Wnt signaling pathway
    395037 (ppp3r1)
   04370 VEGF signaling pathway
    395037 (ppp3r1)
   04020 Calcium signaling pathway
    395037 (ppp3r1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    395037 (ppp3r1)
   04210 Apoptosis
    395037 (ppp3r1)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     395037 (ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagcaagctatccgctggaaatgtgctcacatttcgatgctgatgagatc
aaaaggctagggaaaaggttcaagaaactggatttagacaactctggttccctgagtgtg
gaggagttcatgtcgttaccagagcttcaacagaaccctcttgtgcagcgagtaatagac
atattcgacacggatggaaacggagaagtagattttaaagagtttatcgaaggagtgtcc
cagttcagcgtcaaaggtgataaggagcagaaactgaggtttgcttttcgtatatatgat
atggacaaggatggctacatctccaatggtgagcttttccaggtactgaagatgatggtg
ggaaacaatctcaaagacactcagttacagcaaatagtagacaaaacgattatcaatgca
gataaagatggggatggaaggatatcctttgaagaattctgtgctgtcgtaggaggctta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system