KEGG   Xenopus tropicalis (western clawed frog): 395048Help
Entry
395048            CDS       T01011                                 

Gene name
p4hb, dsi, erba2l, git, pdi, pdia1, po4db, po4hb, prohb
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xtr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 506 aa AA seqDB search
MMRAVLLFGCSLLIVARANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALA
PEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGR
EAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVD
DIPFGITSSEAAFSKYELGKDGIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDV
SDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENI
IIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAAD
EDLEDLEDADESDLEEGDEAHTKDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgcagttcttctattcggctgttccctattaatcgtcgccagggccaatatt
cccgaggagcgggatgtactggtgctaaagaaagacaactttgatgaggcgttaaagcag
tacccgtttattctagtggaattctatgctccctggtgtggtcactgcaaggcactggct
ccagaatatgaaaaggctgctggcgtattaaaaagtgaaggtttgccgatccgcctgggc
aaggtagatgctacagaggagtctgatctggctcaggagtttggcgttagagggtaccca
acaattaaattcttcaaaaatggtgacaaggcttctcctaaagaatattcagctggcagg
gaggcagcagacattgtcaactggctgaagaagcgtactggcccagctgccagcacttta
ggtgatgaggcaggtgttgcagctttggtggattccagcgaagtcgcagttattggtttc
tttaaggatccagcgtcagagccagctaaagtgttcctacaagcagcagaggcagtggat
gatattccatttggtatcacatccagcgaggcagccttttcaaaatatgaacttggcaag
gatggcattgttctgtttaagaagtttgatgaaggccgaaatgcatatgagggagatatc
accaaggaagaagttttgagcttcataaaggccaatcgtttgcctctggttatagaattt
actgagcagactgctccaatgatctttggtggagagattaagactcatattctctttttt
ttgccgaaaagtgcctctgattacaaagaaaaattagaggactttaaaaaggcagctgca
agcttcaaaggaaagatcctcttcatctttattgatagtgatcacacagacaaccaacgt
atcctggagttcttcggtttaaagaaggaagaatgcccagctgtccgacttataacttta
gaagaagaaatgacaaaatacaagccagagagtgctgatctctcagctgaggcaattaaa
gagttctgtgacagtttcttagagggcaaagtcaagccacatttaatgagccaggatgtt
tcagatgactgggacaagaaccctgtgaaaatcttggtggggaaaaactttgaggaagtt
gtctttaatgaggagaagaatgtatttgtagaattctatgctccatggtgtgggcactgc
aagcaactggcacccatctgggaccaactgggggagaagtataaggaccacgaaaacata
atcattgccaagatggattctacagcaaatgagatagaagctgttaagattcacagcttc
cctacactgaagtttttccctgctgggccaggaaagaatgtggctgattataatggtgaa
agaactctagaaggcttttcaaagtttttggagagcggtgggcaggatggagctgctgat
gaggatcttgaagatttagaagatgctgatgagtctgatttggaggagggagatgaagca
catacaaaagatgaattataa

DBGET integrated database retrieval system