KEGG   Xenopus tropicalis (western clawed frog): 395048Help
Entry
395048            CDS       T01011                                 

Gene name
p4hb, dsi, erba2l, git, pdi, pdia1, po4db, po4hb, prohb
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395048 (p4hb)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     395048 (p4hb)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   395048 (p4hb)
  Exosomal proteins of colorectal cancer cells
   395048 (p4hb)
  Exosomal proteins of bladder cancer cells
   395048 (p4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 506 aa AA seqDB search
MMRAVLLFGCSLLIVARANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALA
PEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGR
EAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVD
DIPFGITSSEAAFSKYELGKDGIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDV
SDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENI
IIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAAD
EDLEDLEDADESDLEEGDEAHTKDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgcagttcttctattcggctgttccctattaatcgtcgccagggccaatatt
cccgaggagcgggatgtactggtgctaaagaaagacaactttgatgaggcgttaaagcag
tacccgtttattctagtggaattctatgctccctggtgtggtcactgcaaggcactggct
ccagaatatgaaaaggctgctggcgtattaaaaagtgaaggtttgccgatccgcctgggc
aaggtagatgctacagaggagtctgatctggctcaggagtttggcgttagagggtaccca
acaattaaattcttcaaaaatggtgacaaggcttctcctaaagaatattcagctggcagg
gaggcagcagacattgtcaactggctgaagaagcgtactggcccagctgccagcacttta
ggtgatgaggcaggtgttgcagctttggtggattccagcgaagtcgcagttattggtttc
tttaaggatccagcgtcagagccagctaaagtgttcctacaagcagcagaggcagtggat
gatattccatttggtatcacatccagcgaggcagccttttcaaaatatgaacttggcaag
gatggcattgttctgtttaagaagtttgatgaaggccgaaatgcatatgagggagatatc
accaaggaagaagttttgagcttcataaaggccaatcgtttgcctctggttatagaattt
actgagcagactgctccaatgatctttggtggagagattaagactcatattctctttttt
ttgccgaaaagtgcctctgattacaaagaaaaattagaggactttaaaaaggcagctgca
agcttcaaaggaaagatcctcttcatctttattgatagtgatcacacagacaaccaacgt
atcctggagttcttcggtttaaagaaggaagaatgcccagctgtccgacttataacttta
gaagaagaaatgacaaaatacaagccagagagtgctgatctctcagctgaggcaattaaa
gagttctgtgacagtttcttagagggcaaagtcaagccacatttaatgagccaggatgtt
tcagatgactgggacaagaaccctgtgaaaatcttggtggggaaaaactttgaggaagtt
gtctttaatgaggagaagaatgtatttgtagaattctatgctccatggtgtgggcactgc
aagcaactggcacccatctgggaccaactgggggagaagtataaggaccacgaaaacata
atcattgccaagatggattctacagcaaatgagatagaagctgttaagattcacagcttc
cctacactgaagtttttccctgctgggccaggaaagaatgtggctgattataatggtgaa
agaactctagaaggcttttcaaagtttttggagagcggtgggcaggatggagctgctgat
gaggatcttgaagatttagaagatgctgatgagtctgatttggaggagggagatgaagca
catacaaaagatgaattataa

DBGET integrated database retrieval system