KEGG   Xenopus tropicalis (western clawed frog): 407885Help
Entry
407885            CDS       T01011                                 

Gene name
elp3
Definition
elongator acetyltransferase complex subunit 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     407885 (elp3)
Transfer RNA biogenesis [BR:xtr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    407885 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 549 aa AA seqDB search
MKPDRGPRGKQSQAELMMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLV
DIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALS
EDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDT
EQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPY
QVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPELKGGVSIVRELHVY
GSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSCKIAVISGVGTRNYYRKLGYELE
GPYMVKKLD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggacagggggccgagggggaagcagagccaggccgagctgatgatgatgacg
gtcgctgatgtaattaagcagcttgtggaggctcatgagcagggaaaggacgtcaatctg
aacaagttgaaaacgaaaacttcggccaagtacggactgtctgcgcagccgcgcctggtg
gatatcattgccgccgtccccccccagtaccggaaaatcctggtgcccaagctaaaagca
aagcccatccgaactgctagcgggattgccgtggtcgctgttatgtgcaaaccccacaga
tgcccccatattaactttactggcaacatctgcgtgtactgccccggaggaccagattct
gattttgaatactcgacacagtcatacactggatacgagccaacatcaatgagagccatc
cgtgcccggtacgacccgtatctacagaccaggcatcgggtagagcagctaaagcaattg
ggccacagcgtcgacaaggtggagtttatcgttatgggcggaaccttcatggccctatcg
gaggattacagagacttcttcatccggaatctgcacgatgccttgtctggccatacgtcc
aacagcgtctcggaggccgtacgatattctgaaaggagcaatactaagtgtgtgggcatc
accattgaaaccaggccagattattgcctgaagcgccatctgagcgacatgttgtcctac
ggttgcaccaggcttgagattggggtgcaaagtgtgtatgaagatgtggccagagacaca
aacagggggcacacagtgaaggccgtatgcgagtcctttcacatggctaaagacgccggc
tttaaggtggtctcgcacatgatgccggatctgcccaacgtgggactggagagagacact
gagcagtttattgagttctttgaaaaccctgctttccgcccggatgggatgaagctgtat
ccaacgttggtgatccgtggcaccggtctgtatgagctgtggaaaactggacgatacaga
agttattccccaagcaccctggtggatttggtggcgaggattttggcccttgtgcctcca
tggacacgggtttacagagtgcagagggatataccgatgccactagtaagctctggggtg
gaacatggcaacctgagggaattggcattagccagaatgaaagatttgggcactgagtgc
cgagacgtaagaacgcgagaggtgggaattcaagaaattcatcacaaagtcagaccttat
caggttgagctaattcgcagagattacgtcgctaacggtgggtgggagacatttttatcc
tacgaagatcccgagcaagacatacttatcggcctcctgcgcctacggaaatgttccgaa
cagtccttccggcccgagctcaaggggggcgtgtctattgtgcgggaactgcatgtttac
ggcagcgtggtcccaatcagcagccgcgacccttccaagttccaacatcaggggtttgga
atgctgctgatggaggaagcagagcgaatagcaagggaggaacatggttcctgcaaaatt
gccgttatttcaggtgttgggacaaggaactattacagaaaacttggctatgaattagaa
gggccgtacatggtgaagaagctggactga

DBGET integrated database retrieval system