KEGG   Xenopus tropicalis (western clawed frog): 407934Help
Entry
407934            CDS       T01011                                 

Gene name
creb1, creb
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    407934 (creb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    407934 (creb1)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    407934 (creb1)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    407934 (creb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 327 aa AA seqDB search
MTMESGAETQQSGDAAVTEAEAQQMTIQTQPQIATLAQVSMAAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMANTTASQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPAQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggtgcagagacacagcagagtggagatgccgctgtcacagaggca
gaagcccaacagatgacaatacagacccaaccacagattgcaacattagcacaggtatcc
atggcggctgcacatgcaacctcatctgctcctacagtaacattagttcagttacccaat
ggacagacagttcaagttcatggagttatccaagctgcacagccttctgtcatacagtcc
ccacaagtacaaacagtgcaaatttccactattgctgaaagcgaagattctcaagaatca
gtagacagtgttactgactctcaaaaacgcagagaaattttgtccaggagaccatcatac
agaaaaattttaaatgacttgtcttcagatgctccaggagtaccaagaattgaggaggaa
aaatcagaagaagaaacttcggctcctgctatcacaacagttactgttccaactcctatc
tatcaaaccagcagtggacagtatattgctattacccaaggaggagcaatacagcttgct
aacaatggtacagatggagtgcaaggacttcagacattaaccatggctaatacaacagca
tcccaaccaggaaccaccattttacaatatgcacagaccacagatggacagcagatactt
gttcctagcaatcaagttgttgtccaagctgcctcaggagatgtacagacataccagatc
cgtacagcacctaccagcactattgcaccaggagtggtaatggcttcttctcctgcactt
cctgcccagcctgctgaagaggctgcacgaaaacgagaagtgaggcttatgaaaaacagg
gaagcagcacgggaatgccgcagaaagaaaaaagagtatgtcaaatgcctagagaacaga
gtagcggtccttgaaaaccaaaacaagacactgatagaggaactgaaagcacttaaagac
ctttactgccacaaatctgactag

DBGET integrated database retrieval system