KEGG   Xenopus tropicalis (western clawed frog): 407961Help
Entry
407961            CDS       T01011                                 

Gene name
entpd2
Definition
ectonucleoside triphosphate diphosphohydrolase 2 (EC:3.6.1.-)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    407961 (entpd2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     407961 (entpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 500 aa AA seqDB search
MANKYLAVLLPILICLAGLIGILLVSLPARDVGENPKYKYGVVLDAGSSHTALFVYKWPA
DKENDTGIVSEHSMCDVQGPGISSYWQDPPKAGKSLEVCLNQAVRDVPSNRHALTPIYLG
ATAGMRLLNWTDPVSSDKVLAAVSATIKSYPFNFRGARILSGQDEGVFGWVTANYLLEKF
IKYNWIGQWFQPRKGTLGAMDLGGASTQITFETADKIENPEDEVTLRLYGQSYRVYTHSF
LCYGRDQVLMRIFSKVIMSQGYKAKVDNPCWPTGYSETMPLSSVYESPCTANERPNGYNP
ATPVTMTGTGNAAQCRKHVESLFQFSSCSFTSCSFDSVFQPNVTGNFIAFSAFFYTVDFI
KNVMKMPVNSIADLDNATNTICSSTWDQLKAKAPTLEKLLNSYCPTANFIYEIISRGYKF
TEDSFPNISFQKKAGDTSIGWALGYMLNLSNMIPAEKPSILKAIDISSWAGVIFLFLLVI
LLSLALLCTFIRFNKGDQSL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagtaccttgcggtgttgctgcccatcctcatctgcctggcggggctcata
ggcatcctgctggtctcccttccggccagggacgttggggagaacccaaagtacaagtat
ggagtcgtgctggacgccggttcctcgcacacagcgctgttcgtatacaagtggccggcg
gataaagagaacgacacgggaattgtgagtgagcacagcatgtgtgacgtgcagggccct
gggatctctagctactggcaggacccccctaaggcagggaagagcctggaggtctgtttg
aaccaagcggtgagggatgtcccatcgaacagacacgccctgactcccatctacctgggg
gccaccgccgggatgaggctgctcaactggaccgacccagtttcctctgacaaagtcctg
gccgccgtcagcgccaccatcaagtcctacccgttcaacttccgcggggccagaatccta
tcggggcaagatgaaggggtatttggttgggtcacggcgaattacctgctggagaagttc
attaagtacaactggattggacagtggtttcagccccggaaggggacgctgggcgccatg
gatctgggcggagcttctactcagatcaccttcgagacggcggataaaatcgagaatccg
gaggacgaggtgactctgcggctctacgggcagtcgtaccgggtgtatacccacagcttc
ctgtgctacgggcgcgaccaggtcctcatgagaatcttctccaaagtcatcatgtcgcag
ggatacaaagcaaaggtggataatccctgttggccgactggttactccgagacaatgccg
ctctccagcgtctacgaatcgccttgcacagccaatgagaggcccaatgggtataacccg
gcgactccggtgaccatgacgggtacagggaatgccgcccagtgccggaagcatgtggaa
tccttattccagttctccagctgcagcttcacctcctgctccttcgacagcgtcttccag
cccaacgtcaccgggaatttcatcgccttttcggctttcttctacacggtggacttcata
aagaacgtgatgaagatgccggtgaacagcatagccgacctggacaatgcgaccaacacc
atctgtagctccacgtgggatcagctcaaggctaaggcccccaccctggagaagctcctt
aatagttactgccccaccgccaacttcatctacgagatcatcagccgcggctacaaattc
accgaggattccttccccaacatctccttccagaagaaggccggcgacacctccatcggt
tgggcgctcggttacatgctgaacctcagcaacatgatcccggcggagaagccctccatc
ctgaaagccattgacatcagctcctgggcgggcgtcatcttcctcttcctcctggtcatc
ctgctgtccctcgccctcctctgcaccttcatccgcttcaataagggcgaccaaagcctt
tga

DBGET integrated database retrieval system