KEGG   Xenopus tropicalis (western clawed frog): 446220Help
Entry
446220            CDS       T01011                                 

Gene name
tacc3, eric1, maskin, xmaskin
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    446220 (tacc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 882 aa AA seqDB search
MSLQIIYDENAGNDITAEKCDLLFSPPTTGRPSILRPSQKDNLPPKNTLKSIKVSFQTPM
RDPQTHRIMTPSVANKPESGFSLDACTQALEQLHLSVSTSCGTNPEEMITSVSNNQPGTD
DLPVRTAGAYSIDFNNLDDMNPFKSKTQMLNSPIKADLPSPMEKIETNTPVILADKDTIW
SEALNSSAANLDSPVTVQFSSESSTLGVSDKAALDDTLPFSESGLKDARGSDTSSNNAEE
PILLEKDIAAVTSSANNEANAQSPPLVPKGSYSFDLDQIEMIDPFKTGGSKLQNSPAGEK
KNPPEDTNEAKAEPVKLEFNFGDGDAPARKPPPKKLGKRPPFKTATKKPAPKQEIVSETP
EEQTAKPPEEQAIVPKASYKFDWEKFDDPNFNPFGCGGSKICSSPKGQKTANEEQSAGIQ
DSTSKAECSETDLAPPENEDGKKDLGETEPAQDSVAPEDKSEAENTSVALSNVTPHEPAA
DCSPVQNETQPEVSTVSDEHFQKELDLTSSNLTDPIINGTDMAFNLPTDADFFPAADMDF
KPASEIFPGGFGQPIEIDYLENFGSNSFKESALRKQSLYLKFDPLLRESPKKNAAGNNLI
TSLPLKSSSELFGTIPEANFPLIQSIENEEKPKGLDLLGTFTVTDTAPLIVGAPCSGPVQ
DPFLLNSDAIVEVLKYSQKDMDAAIEAVRLEVQEKELEVLEWKNKHEKLYLEYVEMGKII
AEFEGTITQMLEDSQRQKEMGKLELSKVLQEKQQVQVDLNSMEKSFSEMFKRFEKQKEVL
EGYRKNEEALKKCVEDYLARIKKEEQRYQALKAHAEEKLNRANEEIAHVRSKAKAEATAL
QATLRKEQMKTQSLERSLEQKSKENDELTKICDDLILKMEKI
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgagcctacaaatcatatacgatgaaaatgcaggaaatgatataactgcagagaagtgc
gacttgttgtttagtcctccaactaccggccgaccttctatcctacggccctcgcagaaa
gataatctgccaccaaaaaacactcttaaaagcataaaggtgagttttcagacaccgatg
cgagacccccagactcacagaattatgacacccagtgttgcaaacaagccagagagtggc
ttctcgttggatgcttgtacacaagcactggagcagctgcacttgtctgtgtccactagc
tgtggaacaaatccagaagaaatgattacctctgtttccaacaaccagcctggaactgat
gatttacctgtaaggactgctggggcatatagcattgattttaacaacttggatgacatg
aacccatttaagagtaaaacacaaatgctaaactccccaataaaagctgatcttccaagc
cctatggagaaaatagaaaccaacactcctgtaattctagcagataaagacaccatttgg
tcagaggctttgaattcatctgcagcaaatctggattccccagtcacagttcagttctct
tctgaaagcagcaccttgggtgtatcggataaagctgccctggatgacacccttcctttc
tctgagtccggccttaaagatgcacgtgggtcggatacatcatccaataatgcagaagag
ccgatattattagaaaaggacattgctgctgtgacaagttcagcaaataatgaagctaat
gcccaaagtccacctcttgtccctaaaggctcatacagttttgaccttgatcagattgaa
atgattgatccttttaaaaccggaggttccaagcttcagaattcgccagcaggggaaaag
aaaaatccgccagaagatacaaatgaggccaaagctgaaccagtgaagctggagtttaat
tttggtgatggcgatgctcctgcaagaaaacctccacccaaaaaactaggaaagagacca
ccttttaaaactgcaaccaagaaaccagctccgaaacaggaaattgtatccgaaacacca
gaagagcaaactgcaaagccaccagaagagcaagccattgttccaaaggcatcttataaa
tttgactgggagaagtttgatgatccaaattttaatccttttggatgtggcggttcaaag
atctgcagctctcctaagggccaaaagacagccaacgaagagcaaagtgccggcatacag
gacagtacatccaaagcagaatgctctgaaactgacttggcaccacctgagaatgaagat
gggaagaaggaccttggggagacagagcctgcccaggattctgttgctcctgaagataaa
tcagaagcagaaaatacatctgtggctttaagtaatgtaacaccacatgagccagctgct
gattgttcccctgtgcaaaatgagacacaaccagaagtttctacagtcagtgatgaacat
ttccaaaaggaactggaccttacaagttcaaatttgactgatccaataataaatggaaca
gatatggcgtttaacttacccacagatgcagactttttcccagctgcagatatggacttt
aaaccagcttcagaaattttccctggcggatttggtcagcccattgaaatcgattatcta
gagaattttggcagtaattcatttaaggaatcggcgcttaggaagcagtctctctatctg
aaattcgatcccttgttgagggagtctccaaagaaaaatgctgcaggcaacaacttgatt
accagtcttccactgaaaagcagttcggagctttttgggacaataccagaagccaacttc
ccccttatccaatctatcgaaaatgaggaaaaacctaagggactggatcttctggggact
ttcacagttacggacactgctcctttaattgttggtgctccatgcagtggtcctgttcaa
gatcctttccttctaaattctgatgccattgttgaggtgctgaagtacagccaaaaagac
atggatgcagcaatagaagcagtgcggttagaggttcaagaaaaggagttggaagtactg
gagtggaagaacaaacatgaaaagctctatcttgaatacgttgaaatggggaaaattatt
gcggaatttgaaggcaccatcacacaaatgctagaggactctcaaaggcagaaagaaatg
ggcaaacttgagctcagtaaagtgttgcaagagaagcagcaagtccaggtggatctaaac
tctatggaaaagtctttctctgagatgtttaagagattcgagaaacagaaggaggtgctg
gaaggataccggaagaacgaagaggcactgaaaaaatgtgtagaggactatctggcgagg
attaaaaaggaagagcagcgctaccaagccctgaaggcccacgccgaggagaaactcaat
agagcgaatgaggagattgctcacgtcaggagtaaagccaaggctgaagcgacagctctg
caggcgacactgcgcaaagagcaaatgaagactcagtccctggagcgctcccttgagcaa
aagagtaaagaaaatgatgagctgacaaagatatgtgatgatcttattttaaagatggag
aagatctga

DBGET integrated database retrieval system