KEGG   Xenopus tropicalis (western clawed frog): 447956Help
Entry
447956            CDS       T01011                                 

Gene name
usp16, ubp-m
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     447956 (usp16)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   447956 (usp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 864 aa AA seqDB search
MVKKRGKNLPAQDSLDAEPVCKHLRKALDEGSVKKALVNVEWTVCQECQADNKEKNNSDD
ELVEDPSVWLCLKCGHRGCGRNSASQHALNHYNTPRSEPHCLVLSMDMWSAWCYLCDNEV
PYNRSSRLGQLVDYLQRKAKAKSKSTDSAALDEEVKAEIVAENEVKIEDQEEKPKGQAKW
DKASSTQNNSTEPTVKGLSNLGNTCFFNAVMQNLSQTPAVRELLNEAKTLKKPVTVPLPD
SSSPTNVEVHLEQQPGPLTLAMWQFLTEMQETKKGVVTPKEVFSQVCKKAIRFKGYQQQD
SQELLRYLLDGMRGEEIQRVSLAMSKSLQNTLDEEEIKKIVKDSEKRRTIPNFVDHLFGG
ELTSTIMCEECHTVSLVHEPFLDLSLPVLDDVIVKKNSQKSSAPVPERKEEEENDDGYIK
ERDEASPGASKHLQKKAKKAAKKQAKNQRRQQKMQGKTVLLTDVAKQECSEDEEEIAPNN
TESEANTRPDDEVPTADGLNTMKSDLSALENGSEAIESAMERVTEDTDIDTSGHNTESVE
MNAMELVGNMENNNNNNTDVNKTLERTEGSGGDSMEATAAVDNGNADTVCVDDTEAANGL
LDCSAASMDNELTNSLNRLKLSSDIEPTQVEIEILPDQQQPHTQIYEVINEDPKTAFSTL
SERKDLPLDGYSVLSCLYQFTHKETLTGNNKLLCNVCTRKQASRLNNSNKGEKKFVYTNA
KKQMLVSDPSPILTLHLKRFQQNGFNLRKINRHIKFPEVLDLAPFCTSKCKNIPAGESRL
LYSLYGVIEHSGSMRSGHYTAFVKLRRPNQQLCEMVLKGVIPEVSGSEPGQGSWYHISDS
HVQAVSLSRVLSSQAYLLFYERML
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagcgagggaagaacctccctgcccaggactctcttgatgcagagccagtg
tgcaagcacctccgcaaggcgctggatgaagggagtgtgaaaaaggcactggtgaatgtg
gaatggacagtgtgccaagaatgccaggcagacaacaaggagaagaataactcagatgat
gagttggttgaagacccttctgtctggctgtgtttaaaatgtggccatcggggctgcggc
agaaattctgcgtcacagcatgcactgaaccattacaacacccccaggtcagaaccacac
tgcctggttcttagcatggatatgtggagtgcatggtgctacttatgcgacaacgaggtc
ccctataaccgctctagtcggttaggccagctggtggattatttgcaaagaaaagccaag
gcaaaaagcaaaagtacagattcagctgccttggatgaagaagttaaagctgaaatcgtg
gctgagaatgaagtcaagattgaggatcaggaggagaagcccaaggggcaagccaaatgg
gacaaagccagtagtacccagaataacagtaccgagcctactgtcaagggcctcagtaac
ttggggaacacgtgttttttcaatgcggtgatgcagaacctatcccagacacctgctgta
agggaacttctaaatgaggcaaaaacattaaagaaaccagtgactgttccactgccggat
tcatcatctcctaccaatgtagaggtacatctagagcagcagccaggacccctgaccttg
gcaatgtggcaattcctgactgaaatgcaggagacaaaaaaaggagttgtcaccccaaag
gaggtcttttctcaggtctgtaaaaaagcaatacggtttaaaggctaccagcaacaagac
agccaggaattgcttcgctacttgttggatgggatgagaggagaggaaatccagagagta
tctctggcaatgtccaagtcactacagaacactttagatgaagaagaaattaaaaagata
gtgaaagatagtgaaaagcgcagaacgattccaaactttgtggatcatttgtttggggga
gagctaacgagcacaatcatgtgcgaagaatgccacacggtgtcgctggtccatgaacca
ttccttgacctctctctgccggtattggatgatgtgattgtaaagaaaaatagtcagaag
tcatcagcaccggttccagagaggaaagaggaagaagaaaatgatgacggctacatcaaa
gagagagacgaagcatcacctggggcaagcaagcacctacagaagaaagcaaagaaggcg
gctaaaaagcaagccaagaatcagcgcaggcagcagaaaatgcaaggaaagacggtgctg
ctcactgatgtggccaagcaagaatgttccgaggacgaggaggagattgctccaaacaat
accgagtcagaggccaacaccaggccagacgatgaggtgcccactgctgatggcttaaac
accatgaaatctgatttgtctgctctggaaaatggcagtgaggctattgaaagtgccatg
gaaagagtcacagaggatacggacattgatacttctgggcataatacggaaagtgtggaa
atgaatgctatggaacttgtgggaaatatggaaaacaacaataacaacaacactgatgtg
aataaaacacttgagaggactgagggcagtgggggagacagcatggaagccacggctgct
gtggacaatggaaatgctgatacggtgtgtgtggatgatacagaggctgccaatggtttg
ttggattgttccgctgccagtatggataatgaactaaccaactctttaaacagactcaag
ctcagctccgacatagaacccacccaggtagagatagagatattacctgaccaacagcag
ccccacacgcagatctacgaggtgataaatgaagaccccaaaacggcattcagtaccctc
tccgaaaggaaggatctgccgctggatgggtactctgtgctcagttgcctctatcagttc
actcacaaagagaccctcactgggaacaacaaactgctctgcaacgtctgcaccaggaaa
caggccagcaggctgaataacagcaataaaggggaaaagaagtttgtttacaccaatgcc
aagaagcagatgttggtgtcggacccttctcccatcctcactctccatttgaagagattc
cagcagaatggatttaacctacggaagattaacaggcatataaagtttcctgaggtgtta
gacttggctccattctgtacctcaaaatgtaagaacatccctgctggagagtcgcggcta
ctgtactccctgtatggcgttattgagcacagcggcagcatgaggtccggccattacaca
gcgttcgtcaaactgcgcagacccaaccagcagctctgtgagatggtactcaaaggagtc
attccagaagtctcaggaagtgaacccgggcagggcagctggtaccatattagtgacagc
catgttcaggcagtgtccctttccagagtgctgagctcccaggcctacctgctcttctat
gagcgaatgctgtaa

DBGET integrated database retrieval system