KEGG   Xenopus tropicalis (western clawed frog): 447975Help
Entry
447975            CDS       T01011                                 

Gene name
ugt2a1, ugt2b11
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    447975 (ugt2a1)
   00053 Ascorbate and aldarate metabolism
    447975 (ugt2a1)
   00500 Starch and sucrose metabolism
    447975 (ugt2a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    447975 (ugt2a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    447975 (ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    447975 (ugt2a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    447975 (ugt2a1)
   00982 Drug metabolism - cytochrome P450
    447975 (ugt2a1)
   00983 Drug metabolism - other enzymes
    447975 (ugt2a1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     447975 (ugt2a1)
Glycosyltransferases [BR:xtr01003]
 Others
  Hydrophobic molecule
   447975 (ugt2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 692 aa AA seqDB search
MLWFHVSLLLQATFLCTVSSEKILAWPADASHWLNLKLILEEVASRGHEVTALIHSANMQ
MGNFKSSPVKMEIFPVPFTKERNFNILNEFIQLWVYDTPYISYWEFYVRTKELLKDAVEL
QMYTCDGVVKNKDLLYKLQNEKFDVVVADPLVPCGELIAEILGVPFVYTFRFSMGNSVER
LCGQLPSPFSYVPGTMAELIDRMSFGERLVNTIHYLFQDLLFALLFQWHWDEYYSEVLDA
SHWLNLRLILEELAHKGHEVTALVHSANMLIDHNLPSAIKAEVFPVAFTKETFLTLQRDF
FNFWIYGIHNMSYWELYEHLKVAVASSLKLQRDTCDGVLKNKELMYKLQNQKFDIVVADP
VAPCGELIAESLGVPFVYSFRFSMGNSLERLCGQLPSPFSYVPGAMTALSDKMSFGQRLA
NTVLYAFQDLIFSLVFQKNWDNYYSEILGRPAKVCEIMGKAEIWLIRTYWDFEYPRPILP
NFKFVGGLHCAPAKPLPEVLWRYSGKKPDALGENTITYDWIPQNDLLGHPKTKAFITHGG
TNGIYEAIYHRVPIVGIPLFAEQPDNIVHMKSKGMAIMLDFNKMGTQDLLDAVNTVINNP
TYKENAMRLSRIHHDQPVKPLDSAVFWIEFVMRHKGAKHLRPASHELTWYQYHCLDVIGF
MFVCLLLFFYITITFLTFCYKKCCRTTKEKNQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgctttggtttcacgtttccctgctacttcaggctactttcctctgtacagtttcctca
gagaagattctggcatggccagctgatgcaagtcattggttgaacttaaaactaatcctt
gaggaggttgcaagtagaggtcatgaagttactgcccttattcattcagccaatatgcaa
atgggcaacttcaaatcttcaccggtaaaaatggaaatttttcctgttccattcacaaaa
gagaggaatttcaatattctgaatgaatttattcaactgtgggtgtatgatacaccttat
atctcctattgggagttctatgtacgtacaaaagaactactgaaagatgcagtggaactt
caaatgtacacttgtgatggtgtagtgaagaataaagacctactgtacaaactacagaat
gaaaaatttgatgtcgttgttgctgacccactagttccttgtggtgagcttatagctgag
attcttggtgtgccttttgtttacacattcaggttttccatgggtaactcagtggaaaga
ctctgtggccagctcccatctccattttcctatgtacctggcaccatggcagaacttatt
gataggatgtcctttggagaaaggctggtaaataccatacactacctgtttcaggattta
ctatttgctttattgtttcaatggcactgggatgaatattacagtgaggtactggatgca
agtcattggctcaacttacgattaatccttgaagagcttgcacataaaggtcatgaagtt
actgcacttgtccattcagccaatatgctaattgaccacaacttaccttcagctataaaa
gctgaagtttttcctgttgcattcacaaaagagacgtttctaacacttcagagggatttt
tttaatttttggatctatggcatacataatatgtcctattgggagttatatgaacatctg
aaggtagcagtagcaagctcgttgaagctacaaagagacacttgtgatggtgttctgaag
aataaggagctcatgtataaacttcagaatcaaaaatttgatattgttgttgcagatcct
gtagctccttgtggtgagctgatagctgagagtcttggggtgccctttgtttactctttc
aggttttcaatgggtaactcactggaaaggctctgtgggcagcttccatccccattctct
tatgtacctggtgctatgactgcactcagtgataaaatgtcctttggacaaaggttggca
aatactgtgttgtatgcctttcaagatttaatattttctttggtgtttcaaaaaaattgg
gataattactacagtgagatactaggtcgtcctgcaaaagtttgtgaaatcatggggaaa
gctgaaatttggctgattcgaacatactgggattttgaatatccacgcccaattctaccc
aactttaagtttgttggtggccttcattgtgctccagcaaaacccttaccagaggtgctg
tggcgatatagtgggaagaaaccagatgcattaggggaaaatacaataacatatgattgg
ataccacagaatgatcttctaggacacccaaaaacaaaagcttttataactcatggaggc
acaaatggcatatatgaagcaatttatcacagagttcctattgtcggtattcctctgttt
gctgagcagcctgataacatcgttcatatgaaatccaaaggcatggcaataatgctagat
ttcaacaaaatgggaacccaggacttgctagacgcagttaacacagtaattaacaatccc
acatataaagaaaatgccatgaggttatcacgcatccatcatgaccaaccagttaagccg
ctagacagtgctgtcttttggatagagtttgtaatgcgccacaaaggagccaagcactta
agacctgcctcccatgaactgacatggtaccagtaccactgcttggatgttataggtttc
atgtttgtttgcctgcttctgtttttttacatcactattacattccttacattttgctac
aaaaaatgctgtaggaccacaaaggagaagaaccaataa

DBGET integrated database retrieval system