KEGG   Xenopus tropicalis (western clawed frog): 447991Help
Entry
447991            CDS       T01011                                 

Gene name
bcl2l1, bcl-XL, bcl-x, bcl-x(l), bcl-xl/s, bcl-xs, bcl2l, bclx, bclxl, xR11
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Apoptosis
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    447991 (bcl2l1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    447991 (bcl2l1)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     447991 (bcl2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 201 aa AA seqDB search
MEGSSRDLVEKFVCKKLSQKGACGEFSSNSQPKGVSNGSSEGPGATQGIVGEEVLQALLD
ASEEFELRYQRAFSDLTAQLHLTQDTAQQSFQQVVGELFRDGTNWGRIVAFFSFGRALCV
ESANKEMTELLPRIVQWMVQYLEHTLQPWMLENGGWEAFVGLYGKGAAAQSREGPERFGR
WLMAIVTVTAATLLVSYLRRR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggagggcagcagtagagatctggtggagaagtttgtttgcaagaaactgtcccagaaa
ggagcctgcggggagttctccagcaactcccagcccaagggcgtgtctaatggaagttcg
gagggccccggggccacacagggcattgtgggggaggaagtccttcaggcgctgctggac
gcgtcggaggagtttgagttgagataccagcgtgccttcagcgacctgaccgcccagctg
cacctcacccaggacactgcccagcaaagcttccagcaggtggtgggggagttgttcagg
gacggcaccaactggggcagaatcgtggccttcttctcctttgggcgggccctgtgcgtg
gagagtgccaacaaggagatgactgagctgctccccaggatcgtgcaatggatggtgcag
tacctggagcatacgctgcagccctggatgctggagaacggaggctgggaagcttttgtc
ggtctgtacggaaagggagctgccgcccagagcagggaagggccggagcggtttggccgg
tggctaatggccatagtgactgtgactgctgcaaccttattggtctcctacctgaggcgt
cgatag

DBGET integrated database retrieval system