KEGG   Xenopus tropicalis (western clawed frog): 448019Help
Entry
448019            CDS       T01011                                 

Gene name
echs1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:xtr01200]
Metabolism; Overview; Fatty acid metabolism [PATH:xtr01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:xtr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xtr00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:xtr00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:xtr00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:xtr00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:xtr00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xtr00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:xtr00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 286 aa AA seqDB search
MAMVSWGIFAPLSQIRQCLRRGYSAGSAFQYILVERKGQHHNVGLIRLNRPKALNALCDG
LMTEINQALDTFEEDPNIGAIVITGSERAFAAGADIKEMQNRSFQECYGGNFLSHWNRVS
FVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAEFGQPEILLGTIPGAGGTQRLTRAVG
KSLAMEMVLSGDRISAQEAQQAGLVSKVYPVDSVVDQAIICGEKIARNSKLIVSIAKEAV
SAAFELSLAEGNRLEKRLFHSTFATEDRKEGMTAFVEKRKANFTDK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggttagctggggaatatttgctcctctaagtcagatccgtcagtgccttcgt
agaggctacagcgccggatcagcttttcaatatatacttgtggagagaaaggggcagcat
cataatgttggattgatccgtctgaaccgaccaaaggctttgaatgcactgtgtgatgga
ttgatgacagagatcaatcaggcattggatacttttgaagaagacccaaacattggtgct
attgttattactggtagtgaaagggcatttgctgctggggcagatataaaagaaatgcag
aacaggagtttccaggagtgctatggtggtaacttcctctctcattggaaccgtgtgtcc
tttgtcaagaagccagttattgctgctgttaacggatatgcgcttggaggagggtgtgaa
cttgccatgatgtgcgacatcatatatgctggagagaaggcagaatttggacagccagag
atactgctaggtaccatcccaggtgcaggtggaactcagaggctcacaagggctgttggc
aagtccctggcaatggaaatggtacttagcggtgaccgcatttctgctcaggaagcccaa
caagcagggcttgtgagcaaagtttaccctgtggatagcgtagtagatcaggctattatc
tgtggagagaagattgctagaaactccaagcttattgtgtcaattgcaaaggaggctgtc
agtgcagcttttgagctgtctttggcagaaggcaacagacttgagaaaaggctatttcat
tctacgtttgctacagaggaccgtaaagaaggaatgacagcttttgtggagaagagaaaa
gcaaacttcacagataaataa

DBGET integrated database retrieval system