KEGG   Xenopus tropicalis (western clawed frog): 448019Help
Entry
448019            CDS       T01011                                 

Gene name
echs1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    448019 (echs1)
   01212 Fatty acid metabolism
    448019 (echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    448019 (echs1)
   00650 Butanoate metabolism
    448019 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    448019 (echs1)
   00071 Fatty acid degradation
    448019 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    448019 (echs1)
   00310 Lysine degradation
    448019 (echs1)
   00380 Tryptophan metabolism
    448019 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    448019 (echs1)
Enzymes [BR:xtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     448019 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 286 aa AA seqDB search
MAMVSWGIFAPLSQIRQCLRRGYSAGSAFQYILVERKGQHHNVGLIRLNRPKALNALCDG
LMTEINQALDTFEEDPNIGAIVITGSERAFAAGADIKEMQNRSFQECYGGNFLSHWNRVS
FVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAEFGQPEILLGTIPGAGGTQRLTRAVG
KSLAMEMVLSGDRISAQEAQQAGLVSKVYPVDSVVDQAIICGEKIARNSKLIVSIAKEAV
SAAFELSLAEGNRLEKRLFHSTFATEDRKEGMTAFVEKRKANFTDK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggttagctggggaatatttgctcctctaagtcagatccgtcagtgccttcgt
agaggctacagcgccggatcagcttttcaatatatacttgtggagagaaaggggcagcat
cataatgttggattgatccgtctgaaccgaccaaaggctttgaatgcactgtgtgatgga
ttgatgacagagatcaatcaggcattggatacttttgaagaagacccaaacattggtgct
attgttattactggtagtgaaagggcatttgctgctggggcagatataaaagaaatgcag
aacaggagtttccaggagtgctatggtggtaacttcctctctcattggaaccgtgtgtcc
tttgtcaagaagccagttattgctgctgttaacggatatgcgcttggaggagggtgtgaa
cttgccatgatgtgcgacatcatatatgctggagagaaggcagaatttggacagccagag
atactgctaggtaccatcccaggtgcaggtggaactcagaggctcacaagggctgttggc
aagtccctggcaatggaaatggtacttagcggtgaccgcatttctgctcaggaagcccaa
caagcagggcttgtgagcaaagtttaccctgtggatagcgtagtagatcaggctattatc
tgtggagagaagattgctagaaactccaagcttattgtgtcaattgcaaaggaggctgtc
agtgcagcttttgagctgtctttggcagaaggcaacagacttgagaaaaggctatttcat
tctacgtttgctacagaggaccgtaaagaaggaatgacagcttttgtggagaagagaaaa
gcaaacttcacagataaataa

DBGET integrated database retrieval system