KEGG   Xenopus tropicalis (western clawed frog): 448019Help
Entry
448019            CDS       T01011                                 

Gene name
echs1
Definition
(RefSeq) enoyl-CoA hydratase, short chain, 1, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00062  Fatty acid elongation
xtr00071  Fatty acid degradation
xtr00280  Valine, leucine and isoleucine degradation
xtr00310  Lysine degradation
xtr00380  Tryptophan metabolism
xtr00410  beta-Alanine metabolism
xtr00640  Propanoate metabolism
xtr00650  Butanoate metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr01212  Fatty acid metabolism
Module
xtr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
xtr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
xtr_M00085  Fatty acid biosynthesis, elongation, mitochondria
xtr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    448019 (echs1)
   00650 Butanoate metabolism
    448019 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    448019 (echs1)
   00071 Fatty acid degradation
    448019 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    448019 (echs1)
   00310 Lysine degradation
    448019 (echs1)
   00380 Tryptophan metabolism
    448019 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    448019 (echs1)
Enzymes [BR:xtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     448019 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 448019
NCBI-ProteinID: NP_001005437
Xenbase: XB-GENE-5945792
UniProt: Q6GLG0
Position
7
AA seq 286 aa AA seqDB search
MAMVSWGIFAPLSQIRQCLRRGYSAGSAFQYILVERKGQHHNVGLIRLNRPKALNALCDG
LMTEINQALDTFEEDPNIGAIVITGSERAFAAGADIKEMQNRSFQECYGGNFLSHWNRVS
FVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAEFGQPEILLGTIPGAGGTQRLTRAVG
KSLAMEMVLSGDRISAQEAQQAGLVSKVYPVDSVVDQAIICGEKIARNSKLIVSIAKEAV
SAAFELSLAEGNRLEKRLFHSTFATEDRKEGMTAFVEKRKANFTDK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggttagctggggaatatttgctcctctaagtcagatccgtcagtgccttcgt
agaggctacagcgccggatcagcttttcaatatatacttgtggagagaaaggggcagcat
cataatgttggattgatccgtctgaaccgaccaaaggctttgaatgcactgtgtgatgga
ttgatgacagagatcaatcaggcattggatacttttgaagaagacccaaacattggtgct
attgttattactggtagtgaaagggcatttgctgctggggcagatataaaagaaatgcag
aacaggagtttccaggagtgctatggtggtaacttcctctctcattggaaccgtgtgtcc
tttgtcaagaagccagttattgctgctgttaacggatatgcgcttggaggagggtgtgaa
cttgccatgatgtgcgacatcatatatgctggagagaaggcagaatttggacagccagag
atactgctaggtaccatcccaggtgcaggtggaactcagaggctcacaagggctgttggc
aagtccctggcaatggaaatggtacttagcggtgaccgcatttctgctcaggaagcccaa
caagcagggcttgtgagcaaagtttaccctgtggatagcgtagtagatcaggctattatc
tgtggagagaagattgctagaaactccaagcttattgtgtcaattgcaaaggaggctgtc
agtgcagcttttgagctgtctttggcagaaggcaacagacttgagaaaaggctatttcat
tctacgtttgctacagaggaccgtaaagaaggaatgacagcttttgtggagaagagaaaa
gcaaacttcacagataaataa

DBGET integrated database retrieval system