KEGG   Xenopus tropicalis (western clawed frog): 448110Help
Entry
448110            CDS       T01011                                 

Gene name
usp14, tgt
Definition
(RefSeq) ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (EC:3.1.2.15)
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     448110 (usp14)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   448110 (usp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 490 aa AA seqDB search
MPLYSVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGT
LKIKSGMTLLMMGSAEALPEEPAVRPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKNSF
IDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFS
PSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPE
LQEKMVSYRSKFKQLEDKKGSEQAPKANQMSQREVRYEPYAFPGDVGSINSGYYELQAVL
THQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRR
IEASDEETEQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtattcagtgaatgtcaaatggggaaaggagaagtttgataatgtggaactg
aacacagatgagccccccatggttttcaaagcacagctgtttgcactgactggggtgcag
ccagatagacaaaaggttatggtaaaaggaggaacattaaaggatgatgactggggaacc
ttaaaaataaagtctggcatgactttgttaatgatgggatctgctgaagctctgccagag
gaacctgcagtgagaccagtctttgtagaagacatgacagaagagcagctggcgtctgct
atggagttaccttgtggcctaacaaaccttgggaacacatgttatatgaatgctactgtt
cagtgtatccgatctgttccagagctgaaagaagcacttaaaaggtatgcaggtgccttg
agagcttcaggcgaaatggcctctgcccagtatattactgcagctctaagagatttgttt
gactctatggataaaacatcctccagtatcccaccaatcatcctcctccagtttctacac
atggcttttccacagtttgcagagaagggggatcaggggcagtatcttcaacaggatgct
aatgagtgctgggtgcaagtaatgagagtcctgcagcagaagttagaagcaatagaagga
gattctgatatggagacagattcgggagcagctgcaacagcctcgaagaaaaatagcttc
atcgaccagttttttggcattgagtttgagtcaaccatgaaatgtactgaatctgaagac
gaggaagttactaaaagtaaagagacacagttgcagcttagctgttttattaaccaggaa
gtgaaatatctgttcactggcctcaaactgcgccttcaagaagaaatcacaaaattttct
ccatcattgcagagaaatgctctgtatatcaaaacttccaggatcagtcgtttacctgcc
tacctgactatccagatggtccgattcttttacaaagagaaggaatctgtgaatgccaaa
gttctcaaggatgtgaaatttcctctcatgttggacatatatgaattatgtacaccagag
cttcaagaaaagatggtgtcatatcgttcaaagttcaagcaattagaagataagaaaggt
tcagaacaagcacccaaagcaaaccaaatgtcccagagagaagttcgatacgaaccatat
gcctttccaggtgatgttggctcaattaattctggttactatgagctgcaggcagttcta
actcatcaaggaagatcaagttcttctgggcactatgtatcctgggtaaagagaaaacac
gatgaatggattaaatttgatgacgacaaagtaagcattgtgtctcctgaagatattctg
agattatctgggggaggagactggcatatagcttatgtccttctgtacggacctcgacga
atcgaagctagcgacgaagagactgaacaatga

DBGET integrated database retrieval system