KEGG   Xenopus tropicalis (western clawed frog): 448134Help
Entry
448134            CDS       T01011                                 

Gene name
otud5, DUBA
Definition
OTU domain-containing protein 5 (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xtr04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 518 aa AA seqDB search
MTILPKKKPPPPSDPEGNGERSGSGGADSHSRSGARPRSSPPPRWAYPGNPAPPERHPAG
TPRPQQASPPPCSGGSGGAGSGPLGEGALGPCCCCTGAGGCCSGPGHSKRRRQGVSAGPG
APGSSPDREDGAGNNSEDEYETAARTQAIDPDTAEQQEHWFEKALQEKKGFIIKQMKEDG
ACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNH
IEMQAMAEMYNRPVEVYQYGTEPINTFHGIQQNEDEPIRVSYHRNIHYNSVVNPNKATIG
VGLGLPSFKPGFAEQSLMKSAIRTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESY
LQWLRDQEKQARQPRKASATCSSATAAASSGLEEWSGRSPRQRSTAGSPEHPDLHAELCM
KPPSPAATLMLGKPPSPCAPGPSNQTCAGADRATSPLVSLYPALECRAIMQHMSPTAFGL
KDWDDDEILASVLAVSQQEYLDTIKKSTLRRDSSPDHS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctgcccaagaagaagccgcctcccccctcggacccagagggaaatggggaa
cggagcggctccgggggcgctgactcgcactcccgctctggggcccggccccgctcctcc
ccgcccccgcgttgggcctaccccgggaaccccgcacccccagagcgccaccctgccggc
accccccgcccccagcaagcctctccgcccccatgcagcggggggtccggcggggccggc
tctgggcccctgggagagggagctctggggccgtgctgctgctgtaccggtgccgggggc
tgctgttcggggcccggacacagtaagcggaggagacagggggtgagcgcagggcctggg
gccccggggagcagcccggatagggaggatggagccgggaacaacagtgaggatgagtat
gagactgcggcccggacccaggccatagaccccgacactgccgagcagcaggagcactgg
tttgagaaggcgctgcaggagaagaagggatttatcatcaaacaaatgaaggaggacggg
gcctgtctgttcagagctgtggccgatcaggtgtatggggaccaggacatgcacgaggtg
gtccgcaagcactgcatggattacttgatgaaaaacgccgactacttctctaattacgtg
actgaggattttaccacctacatcaaccgcaaacgcaagaacaattgtcatggcaaccac
atcgagatgcaggcaatggccgagatgtacaaccggcccgtcgaggtgtatcagtacgga
acagaaccaatcaacacatttcatggcattcagcaaaatgaagatgaaccaatcagagtc
agttaccatcggaacattcattacaactcggtggttaaccctaacaaggccacgattgga
gtggggctaggcctgccttccttcaagcctgggtttgccgagcagtccctgatgaagagc
gccatcagaacctccgaggagtcgtggatcgagcaacagatgttagaggataagaaaagg
gccacggactgggaggccacaaatgaggccatagaggagcaagtggctcgggaatcctac
ctgcagtggctacgggaccaggagaaacaagcccgacagccacggaaagccagtgcaacg
tgcagttctgcgacggcggcggcatccagcgggctggaggaatggagcggccgatcccca
cggcaacgcagcacggcagggtcccccgagcaccccgacctacatgctgaactgtgtatg
aagccgccgtccccagctgccaccctaatgttgggcaagccaccgtcgccttgcgcccca
ggccctagcaaccagacgtgtgcgggcgctgaccgtgccacctcaccgcttgtgtccttg
tacccggccctggagtgcagagcaatcatgcagcacatgtcgcccacggcattcgggctg
aaggattgggacgacgatgagatcctggcgtcggtgttggccgtctcgcagcaggaatac
ctggacaccataaagaagagcaccctgaggcgagactcctcccccgaccacagctga

DBGET integrated database retrieval system