KEGG   Xenopus tropicalis (western clawed frog): 448157Help
Entry
448157            CDS       T01011                                 

Gene name
pgam2, pgam1
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00260  Glycine, serine and threonine metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr01230  Biosynthesis of amino acids
Module
xtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xtr_M00002  Glycolysis, core module involving three-carbon compounds
xtr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    448157 (pgam2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    448157 (pgam2)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     448157 (pgam2)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    448157 (pgam2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   448157 (pgam2)
  Exosomal proteins of melanoma cells
   448157 (pgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 448157
NCBI-ProteinID: NP_001005665
Xenbase: XB-GENE-971122
UniProt: Q6GL24
Position
3
AA seq 253 aa AA seqDB search
MPHRLVIVRHGESSWNQENRFCGWFDADLSEKGAEEARRGAQAIKEAGMEFDICYTSVLK
RAVRTLWYILDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDI
PPPVMGEDHSYYKLISKDRRYKDLTQKELPSCESLKDTIARALPFWNEVIAPQILAGKRV
MIAAHGNSLRGIVKHLDGMSDAAIMELNLPTGIPIVYELDDNLKPIKPMSFLGDEETVRK
AMEAVAAQGKVKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccgtctggtaattgtacgccacggggaaagctcatggaatcaggagaacaga
ttctgtggatggttcgatgccgacctgagtgagaaaggggcagaggaggctcgcagagga
gctcaggcaataaaggaggccggaatggagtttgacatctgctacacctcagtgctgaag
agggcagtgcgtacactatggtacatcttggatggaatagaccaaatgtggctgccagtg
gtcaggacctggagactcaatgagcgccactatgggggactgacaggcctcaacaaggca
gagacggcggagaaacatggggaagagcaggtgaagatatggagaagatcttttgacatc
ccaccaccagtcatgggagaagatcattcatactataagcttataagtaaggaccgtcgg
tacaaagatctcactcagaaagagctgccatcctgtgagagcctgaaggacaccattgcc
cgtgccctcccattttggaacgaagtgattgccccccagatcctggcaggaaagcgcgta
atgatagcggcacatggaaacagcttgagaggcattgtcaagcacctggatgggatgtcc
gatgctgccattatggaactcaatctacccactggaattcccattgtttatgaactagat
gataacctgaagccaatcaaacccatgagcttccttggggatgaggaaactgtacgaaaa
gccatggaggcagtggcagctcagggaaaggtcaaaaaatag

DBGET integrated database retrieval system