KEGG   Xenopus tropicalis (western clawed frog): 448157Help
Entry
448157            CDS       T01011                                 

Gene name
pgam2, pgam1
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    448157 (pgam2)
   01230 Biosynthesis of amino acids
    448157 (pgam2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    448157 (pgam2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    448157 (pgam2)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     448157 (pgam2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   448157 (pgam2)
  Exosomal proteins of melanoma cells
   448157 (pgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 253 aa AA seqDB search
MPHRLVIVRHGESSWNQENRFCGWFDADLSEKGAEEARRGAQAIKEAGMEFDICYTSVLK
RAVRTLWYILDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDI
PPPVMGEDHSYYKLISKDRRYKDLTQKELPSCESLKDTIARALPFWNEVIAPQILAGKRV
MIAAHGNSLRGIVKHLDGMSDAAIMELNLPTGIPIVYELDDNLKPIKPMSFLGDEETVRK
AMEAVAAQGKVKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccgtctggtaattgtacgccacggggaaagctcatggaatcaggagaacaga
ttctgtggatggttcgatgccgacctgagtgagaaaggggcagaggaggctcgcagagga
gctcaggcaataaaggaggccggaatggagtttgacatctgctacacctcagtgctgaag
agggcagtgcgtacactatggtacatcttggatggaatagaccaaatgtggctgccagtg
gtcaggacctggagactcaatgagcgccactatgggggactgacaggcctcaacaaggca
gagacggcggagaaacatggggaagagcaggtgaagatatggagaagatcttttgacatc
ccaccaccagtcatgggagaagatcattcatactataagcttataagtaaggaccgtcgg
tacaaagatctcactcagaaagagctgccatcctgtgagagcctgaaggacaccattgcc
cgtgccctcccattttggaacgaagtgattgccccccagatcctggcaggaaagcgcgta
atgatagcggcacatggaaacagcttgagaggcattgtcaagcacctggatgggatgtcc
gatgctgccattatggaactcaatctacccactggaattcccattgtttatgaactagat
gataacctgaagccaatcaaacccatgagcttccttggggatgaggaaactgtacgaaaa
gccatggaggcagtggcagctcagggaaaggtcaaaaaatag

DBGET integrated database retrieval system