KEGG   Xenopus tropicalis (western clawed frog): 448236Help
Entry
448236            CDS       T01011                                 

Gene name
cyp2c8.2, cpc8, cypiic8, mp-12/mp-20
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8, gene 2 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    448236 (cyp2c8.2)
   00590 Arachidonic acid metabolism
    448236 (cyp2c8.2)
   00591 Linoleic acid metabolism
    448236 (cyp2c8.2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    448236 (cyp2c8.2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     448236 (cyp2c8.2)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP2 family
   448236 (cyp2c8.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 495 aa AA seqDB search
MEPLTIFLCLFIFLLLLFTWKTHKRRVQLPPGPYPLPLLGNVLQGITVLYDSYRKLSEQY
GPVFTVWLGSTPMVVLCGYEVLKDALINHSQEFGARGAFPVPERLTDGYGVISTNGTRWQ
QLRRFSVTVLRNFGMGKRSMEERIHEETQHLIQAVQHTGGEAFDPLYLLGRAVNNIINLI
VFGRRWDYKDKMMIKLFNIINSILLFLRSPLGVIYSALYQIMQHLPGPHQKIFHDSETVK
SFIREQINSHKETLDSDSPRDYIDCFLIKANQEKDHHSSEFSQENLVNTVFDFFVAGTET
ATNTIQFSLLVIITYPHIQAQVQKEIDKVVGPDRLPGIADRAQMPYTNAVIHEIHRFLDL
VPLSLPHMATQDTVCRGFRIPKGTTVIPLIGSALCDPAHWETPEEFNPEHFLNQNGEFYI
PPAFMPFSAGKRVCLGEGLARMEIFLFFTALLQKFTIRVANQTDTFNLRTLRRAFRKKGL
FYQLRAMPRTCTVEK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctgaccatattcctctgcctttttattttcttacttttactctttacatgg
aagacacacaagcgacgagttcaattgccccctggaccctatcctcttccgctgctagga
aatgtgctacaggggatcactgtgctgtatgactcttatcgcaagctttctgagcagtat
ggcccagtgttcactgtgtggctgggttccacaccaatggtggtactctgtgggtatgag
gtgctgaaagatgctttgattaaccactctcaagaatttggtgctcgaggagcctttcca
gtacctgagagactgactgatggatatggtgtcatttcaaccaatggcactcgctggcag
cagttgcgccgcttttcagtcaccgtattaagaaactttggaatggggaagcggtcaatg
gaggagagaatacatgaggagactcagcaccttatacaggctgtacagcacacaggagga
gaagcatttgatcctctctatttacttggccgagcagtaaacaacattattaaccttata
gtgtttggaagacgctgggactataaggataagatgatgatcaaattgtttaacatcata
aatagcattttacttttcctccgatccccattaggagtgatttattcggcattataccag
ataatgcagcaccttcccggcccacatcagaagatattccatgacagtgagacagtgaaa
tcttttatcagagagcagattaattctcataaagaaacactggattcggattccccacgg
gactatattgactgcttcctcatcaaagctaatcaggaaaaggaccaccactcaagtgaa
ttcagccaagaaaatctggtgaacacagtgttcgatttctttgtagcagggacagagacc
gccacaaacaccattcagttcagcttgctagtcattattacatacccccatattcaagcc
caggttcagaaggaaatagacaaagtagttggccctgatcgattgcctgggattgcagac
cgagcccagatgccatacactaatgctgttattcatgagatccatcggttcttggacctt
gtgccactgtcactccctcatatggcaacacaggacacagtatgtaggggtttcaggatc
cctaagggaacaacagtcattccactaattggctcagccctatgtgacccggcccactgg
gaaacacctgaggaattcaatcctgagcacttcctaaaccagaatggagagttttatata
ccgccagcgttcatgccattctcagcaggaaagagagtgtgcctgggagaagggctggct
cgtatggaaatcttcctcttcttcactgccctgctgcagaaattcacaatcagagttgcc
aatcagactgatacattcaacctgaggacgctgaggagggccttccggaaaaaggggcta
ttctatcagctgagagccatgcctagaacctgtactgtggagaaataa

DBGET integrated database retrieval system