KEGG   Xenopus tropicalis (western clawed frog): 448254Help
Entry
448254            CDS       T01011                                 

Gene name
asns
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    448254 (asns)
Enzymes [BR:xtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     448254 (asns)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C44
   448254 (asns)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 561 aa AA seqDB search
MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQ
PLRVKKFPYLWLCYNGEIYNFKQLEKNFGFEYQTLVDGEVILHLYSEHGIEKTAALLDGV
FAFILLDTANRKVYLGRDSYGVRPLFRLLTDDGFLAVCSEAKGLIDLKHSMTSCPKVDPF
PPGHYEVFDLKPSGKVTSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFE
NAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNMHYPLQTFAVGTEDSPDLLAAR
KVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVV
IFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVLWRPKEAFSDGLTSVKKS
WFSMLQEHIEQQVDNIVLEKAAENFPFNPPKTKEGYFYRQIFEKYYPGRAGWLTHYWMPR
WISATDPSARTLKHYKSDTNE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctgggccctttttggcagcgatgaatgcctttcagtgcaatgccttagt
gccatgaagattgcccacagaggccctgatgcttttagatttgagaatgtgaatggtttc
accaactgttgctttggcttccatcgcttggctattgttgaccaactttatggcatgcag
cctcttcgtgtaaagaagttcccttacttatggctttgctacaatggagagatttacaat
ttcaagcagttggaaaaaaattttggatttgaatatcaaacactggtggatggggaagta
atccttcacctctatagtgaacatggaattgaaaaaactgctgccttattggatggtgta
tttgcatttattctcttggatacagcaaacagaaaagtctatttgggaagggactcttat
ggtgtcaggccactcttcagacttttgactgatgatggctttttggcagtttgctctgaa
gccaaaggtcttattgacttgaagcattcaatgacttcatgtccaaaggttgatcctttc
ccaccaggccattatgaagtttttgatttgaaaccttctggaaaagtgacatcggtggaa
gtaatcaaatttcataatttcagagatgaaccactccacgcagcttatgacaccttagat
aaactgcaaccaggaactgatcgtgaaacggtaaaaaggaacatttgttgtttgtttgaa
aatgccgtcagaaagcggttaatggcacacagaagaattggctgtcttttgtcaggtggt
ctggactcaagtttggttgctgcaactcttataaagctaataaaggagcgtaatatgcat
taccccctacaaacctttgcagtaggtacggaagatagtcctgacttattggcagccaga
aaggtagcgttgcatattggcagtgagcaccatgaaatcatgtttgatccagaagaaggg
attcaagcagtagatgaggttatcttttccttggaaacctatgacattaccactgttcgt
gcttctgttggaatgtacttgatctccaaatatataaggaaaaaaacagacagcgtggtc
atattttctggagagggatctgatgagcttactcaagggtatatatatttccacaaggct
ccttctgctgaagaggctgcagaagacagtgagcgattactaagggaactttacttgttt
gatgtacttcgtgcagataggacaacggcagcgcatggtctagagctccgagtgccattt
ttagatcatcgccttactgcttattatctttctttgcctccagagcttagaattcctaag
aatggaatagaaaaatatctcttgagagaatcatttgaagattccaacctgctacccaaa
gacgtattgtggagaccaaaggaagcatttagcgatggtttaacatctgtgaagaaatca
tggttttctatgctgcaagagcacattgaacaacaggtggataatattgtgttggaaaag
gcagctgaaaattttccttttaatccacctaagacaaaggaaggctacttctatcgccag
atctttgaaaagtattacccggggcgtgctggctggctgactcactactggatgcctcga
tggattagtgcaacagatccctctgcccgcacactaaagcattacaagtcagataccaac
gaataa

DBGET integrated database retrieval system