KEGG   Xenopus tropicalis (western clawed frog): 448296Help
Entry
448296            CDS       T01011                                 

Gene name
mapk14, csbp, csbp1, csbp2, cspb1, exip, mxi2, p38, p38alpha, prkm14, prkm15, rk, sapk2, sapk2a
Definition
mitogen-activated protein kinase 14 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:xtr04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xtr04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xtr04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xtr04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xtr04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xtr04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xtr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 361 aa AA seqDB search
MSSNQSYVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEM
TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV
GTPEPELLQKISSEAARNYIQSLPYMPKMNFEDVFLGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPIAEPYDQSFESRELDIEEWKRLTYEEVICFVPPPLDSEEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaatcaatcttacgtcttctacagacaagagcttaacaaaactttgtgggag
gtgcctgataggtaccaaaacctgacaccagtgggttctggggcctacggttccgtgtgt
tcagcatttgacactaggacagaattgcgtgttgctgtgaaaaagctctctcggcccttt
cagtccataattcatgccaagcgaacatacagagaactccgtctgcttaagcatatgaag
catgagaatgtcattggactcctagatgtattcacacctgcaaaatcattcgaagagttc
aatgatgtatatcttgtaacacatctaatgggagctgatcttaataatattgttaagtgt
cagaagcttacagatgaccacgtacagtttcttatctatcaaatcttgcgtggtttaaag
tatattcattcagcaggcattatccacagagacctaaaacctagtaatcttgcagtgaat
gaagactgtgagttaaagattcttgactttggtttggctcgtcatacagatgaggaaatg
actgggtatgttgctactcggtggtacagagcaccagaaatcatgctgaattggatgcat
tacaatcagacagtggacatttggtcagtgggctgtataatggcagagcttctcacagga
aggaccttgtttccaggcacagaccatattgatcaattgaagctaattttgagactggtc
ggaaccccagaaccagagctcctgcagaaaatctcttcggaggctgctcgtaactacatc
cagtccttgccatatatgcctaagatgaattttgaagatgtttttctaggcgccaatcca
caagctgtagacttactagagaaaatgttggttttggatacagacaagcgaataacagca
gcagaggcactagcacacccttattttgctcagtaccatgatcctgatgatgaaccgata
gccgagccatatgatcagagttttgagagtcgtgagttggacattgaagagtggaaacgt
ctaacttatgaggaagtgatctgttttgtgcctcctcccttggattctgaagagatggaa
tcttga

DBGET integrated database retrieval system