KEGG   Xenopus tropicalis (western clawed frog): 448296Help
Entry
448296            CDS       T01011                                 

Gene name
mapk14, csbp, csbp1, csbp2, cspb1, exip, mxi2, p38, p38alpha, prkm14, prkm15, rk, sapk2, sapk2a
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04068  FoxO signaling pathway
xtr04218  Cellular senescence
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04370  VEGF signaling pathway
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04933  AGE-RAGE signaling pathway in diabetic complications
xtr05132  Salmonella infection
Module
xtr_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    448296 (mapk14)
   04370 VEGF signaling pathway
    448296 (mapk14)
   04068 FoxO signaling pathway
    448296 (mapk14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    448296 (mapk14)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    448296 (mapk14)
   04621 NOD-like receptor signaling pathway
    448296 (mapk14)
   04622 RIG-I-like receptor signaling pathway
    448296 (mapk14)
   04625 C-type lectin receptor signaling pathway
    448296 (mapk14)
  Endocrine system
   04912 GnRH signaling pathway
    448296 (mapk14)
   04914 Progesterone-mediated oocyte maturation
    448296 (mapk14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    448296 (mapk14)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    448296 (mapk14)
  Infectious diseases
   05132 Salmonella infection
    448296 (mapk14)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     448296 (mapk14)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   448296 (mapk14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 448296
NCBI-ProteinID: NP_001005824
Xenbase: XB-GENE-1018617
UniProt: Q6DJ17
Position
2
AA seq 361 aa AA seqDB search
MSSNQSYVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEM
TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV
GTPEPELLQKISSEAARNYIQSLPYMPKMNFEDVFLGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPIAEPYDQSFESRELDIEEWKRLTYEEVICFVPPPLDSEEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaatcaatcttacgtcttctacagacaagagcttaacaaaactttgtgggag
gtgcctgataggtaccaaaacctgacaccagtgggttctggggcctacggttccgtgtgt
tcagcatttgacactaggacagaattgcgtgttgctgtgaaaaagctctctcggcccttt
cagtccataattcatgccaagcgaacatacagagaactccgtctgcttaagcatatgaag
catgagaatgtcattggactcctagatgtattcacacctgcaaaatcattcgaagagttc
aatgatgtatatcttgtaacacatctaatgggagctgatcttaataatattgttaagtgt
cagaagcttacagatgaccacgtacagtttcttatctatcaaatcttgcgtggtttaaag
tatattcattcagcaggcattatccacagagacctaaaacctagtaatcttgcagtgaat
gaagactgtgagttaaagattcttgactttggtttggctcgtcatacagatgaggaaatg
actgggtatgttgctactcggtggtacagagcaccagaaatcatgctgaattggatgcat
tacaatcagacagtggacatttggtcagtgggctgtataatggcagagcttctcacagga
aggaccttgtttccaggcacagaccatattgatcaattgaagctaattttgagactggtc
ggaaccccagaaccagagctcctgcagaaaatctcttcggaggctgctcgtaactacatc
cagtccttgccatatatgcctaagatgaattttgaagatgtttttctaggcgccaatcca
caagctgtagacttactagagaaaatgttggttttggatacagacaagcgaataacagca
gcagaggcactagcacacccttattttgctcagtaccatgatcctgatgatgaaccgata
gccgagccatatgatcagagttttgagagtcgtgagttggacattgaagagtggaaacgt
ctaacttatgaggaagtgatctgttttgtgcctcctcccttggattctgaagagatggaa
tcttga

DBGET integrated database retrieval system