KEGG   Xenopus tropicalis (western clawed frog): 448358Help
Entry
448358            CDS       T01011                                 

Gene name
arg1
Definition
arginase 1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    448358 (arg1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    448358 (arg1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     448358 (arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MSSQAKTSVGVIGAPFSKGQPRRGVEEGPKYLRDAGVIEKLRELGNDVRDYGDLDFPDVP
NDITFNNVKNPRTVGKATEKLANAVTAVKKADRTCLVIGGDHSLAVGTIAGHAAVHRDLC
VVWVDAHADINTPSTSPSGNLHGQPLSFLMKELKSKMPDVPGFEWVKPCLSAKDIVYIGL
RDVDPGEHYILKTLGIKYYSMSEVDYLKIDKVMEETIEYLVGKQKRPIHLSFDIDGLDPS
IAPATGTAVPGGLTYREGMYITEKLCRTGLLSAVDIMEVNPSRGETKRDVELTVNTALDM
TLSCFGKAREGYHTSTMTLPDII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccaagcaaagacctcagtgggagtcattggagcccccttctcaaagggacag
ccaagaagaggagtggaagaagggccgaaatatttaagagatgctggggtaattgagaaa
ttaagagaacttggcaatgacgttcgagattatggtgatctggattttcccgatgtgcct
aacgacataacatttaacaatgtgaaaaacccacgcacagttgggaaagccacagagaaa
ttggccaatgctgttacggcggtaaaaaaagctgacaggacatgcttagtcattggggga
gatcacagcttggcagtgggaacaatcgctggtcatgcagcagttcaccgtgatctttgt
gttgtttgggtggatgcccatgcagatattaacactccatccacatcacccagtggcaac
cttcatggacagccattatcctttttaatgaaagaactcaaaagcaagatgcctgatgtt
ccaggatttgagtgggtgaaaccatgcctcagtgccaaagacattgtatacattggttta
agagatgtagacccaggagagcattacattctgaagacacttggcataaaatactattca
atgtctgaagtggattatcttaaaatagacaaagtaatggaagagacaattgaatatttg
gttggaaagcagaagagacccattcatttaagtttcgacattgatggtctggacccaagt
attgccccagctactggaactgctgtccctggagggctgacttacagggaaggcatgtac
atcacagaaaaactctgtaggacaggattgctttcggcagtggatataatggaagtaaac
ccatcacgcggagaaacaaagcgagatgttgagctcacagttaacactgcgcttgacatg
actttgtcatgcttcggaaaagctcgtgaaggatatcatacatcaacaatgacacttcca
gatattatataa

DBGET integrated database retrieval system