KEGG   Xenopus tropicalis (western clawed frog): 448362Help
Entry
448362            CDS       T01011                                 

Definition
MGC89221 protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     448362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 140 aa AA seqDB search
MKIFVLLMITAAFAAHSWALDRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTSLN
RSPTEYGIFQINSYWWCDDGRTVGRKNLCGMSCRSLLNSNIGDDVRCLRRIVRDPNGLDA
WSVWTRYCKGRDLSSYASWC
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctttgttttgcttatgatcactgcagcgtttgctgctcacagctgggcatta
gataggtgcagtgtggtgagagcgattagaaatgggggagttattggcatcaaaggatat
acactgggggactatgtgtgcttagcttaccaagccagccgctacgacacttccctcaac
agaagcccaacagagtatggtatcttccagatcaacagctactggtggtgcgacgatggc
agaaccgtagggcgcaaaaacctctgtggaatgtcttgtagaagtttactgaacagtaac
attggcgatgatgtgaggtgccttagaaggattgtgagagatcccaatggactcgatgct
tggagtgtttggaccagatactgtaaaggaagagacctaagctcatacgccagttggtgc
taa

DBGET integrated database retrieval system