KEGG   Xenopus tropicalis (western clawed frog): 448433Help
Entry
448433            CDS       T01011                                 

Gene name
pomt1
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    448433 (pomt1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     448433 (pomt1)
Glycosyltransferases [BR:xtr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   448433 (pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 725 aa AA seqDB search
MAVSLKSPLVVTVAIDLHFVALTILGLVSRLWRLSYPQAVVFDEVYYGQFISLYMKRIFY
LDDSGPPLGHMLLALGGYVADFDGNFMWNRIGAEYSSNVPVWSLRLLPALSGALCVPLAY
QIVVELGFSARAGLAAGFLLLFENALITQSRLMLLESVLIFFILLALLSYLKFHGCQRRS
PFSVSWWFWLLLTGISCTFAIGVKYMGLFSYLLILGVAAVHYWQLIGDQTLGNVWLLFHL
LARCLALLLMPVLLYLGIFYLHLSILTRSGPHDHIMSSAFQASLEGGLSRITEGQPLEVV
YGSQITLKNTLGKPVPCWLHSHKHTYPVRYEGGRGSSHQQQVTCYPYKDVNNWWIVKDPA
RQQMVVDSPPRPIRHGDTVQLLHGMSARFLNTHDVAAPFSPYSQEVSCYIDYNISMPAQS
LWKVEIVNRESDMDTWKTIISEVKLIHVNTSAALKLSGTALPDWGFRQLEVVGDKASKSY
HQSLVWNVEEHRYGRSQEQSEREQELHTSPHIDVGRNLSFMSRFWELQWKMLTMRTESSE
HKYSSYPMDWITMDTSIAYWLHPKSTAQIQLLGNPVIWNSANLGALIYSALLIFYLLRQR
RRIYDIPQGSWEALQLTGVLFLGGWAVNYLPFFLMEKTLFLYHYLPALTCQILLLPPLLE
HLHQHLLRSEALQNTFAALLLVWGCSVYLTYRKICPLTYGDPPLSPAELRSLRWKDNWDI
LIRKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgtcgctgaaatctccgttagtcgtcaccgttgccatcgatctccattttgtg
gctcttacaatcctgggactggtgagccgactctggagactgtcgtacccccaagcagtt
gtgttcgatgaagtctattacgggcagtttatatccctgtacatgaaaaggatattctat
ttggacgacagtgggccacctctaggtcacatgttgctggctctggggggttacgtcgct
gattttgacgggaacttcatgtggaaccgaattggagccgagtacagcagcaacgtgccg
gtgtggtccctgcgcctccttcctgccctatcgggagctctctgcgtccctctggcctat
cagattgtagtggagctgggattctccgcccgtgccggactggccgccggctttctgctg
ctgtttgagaacgctctgatcactcagtcccgcctgatgctgctggagtctgtgctcatc
ttcttcatcctcctggctctcctgtcctacctcaagttccatgggtgccagcggagaagc
cccttctctgtatcctggtggttctggctgctcctgactgggatctcgtgcacctttgct
attggggtgaagtatatgggacttttctcctacttgcttattctgggggttgctgctgtg
cactactggcagttgattggtgatcagactttgggcaacgtgtggctactcttccatctg
ctggcacggtgcctagccttgcttctgatgcctgtacttctgtaccttggcatattctac
ctacacctgtccatactgacacgttctgggcctcatgaccacatcatgagcagtgccttt
caagccagcctggagggaggcctttcccggatcaccgaggggcagccgttggaagtggtg
tatggctctcagatcaccctcaagaacactcttggcaaacctgtcccctgctggcttcac
tcgcacaagcacacgtatcccgtaaggtacgaaggggggcgtgggagctcccaccagcaa
caggttacctgctacccatacaaagacgtcaataactggtggattgtgaaggacccggca
cggcagcaaatggtggtcgactcccctcctcgtcccatccgtcatggtgataccgtgcag
ctgctacacggaatgtcggcacgcttcctgaacacgcacgatgtggccgctcccttctct
ccgtattcccaggaagtctcctgttacatcgactacaacatctccatgccggcacagtcc
ttatggaaggtggagattgtaaaccgcgaatcagatatggatacgtggaaaaccatcatt
tcagaagtgaagctgattcacgtcaatacttcggcagctctgaagctcagcgggacagct
ttgcccgactggggtttccgtcagctggaagtggtcggagataaagcatcgaaaagttac
caccaaagcctggtgtggaatgtggaggagcaccggtacggcaggagtcaggagcagtcg
gagagagagcaggaattgcacacgtctcctcacatcgacgtgggacggaatctcagtttc
atgtctcgcttttgggagctgcagtggaagatgctgacaatgaggacagagagctcggaa
cacaaatacagctcgtacccaatggactggatcactatggacaccagcattgcctactgg
cttcaccccaagagcacggctcagattcagctcttgggcaaccccgtgatatggaattct
gccaacctgggcgccctcatttactctgctctgctgattttctacctactgcgccagcgg
agaaggatctatgacatcccacaaggttcctgggaggccttgcagctgactggggtgctg
ttcctcgggggctgggctgtgaattacttgccctttttcctgatggagaaaaccctcttc
ctgtaccattaccttcctgctcttacctgccagatccttctgctcccaccactgctcgag
cacctccaccaacatctgctcaggtcggaagcgttacagaacacctttgccgccctgctg
ttggtttgggggtgtagcgtgtacctgacataccggaagatttgccccctgacgtacgga
gacccacccctgtctcccgccgagctgcgcagcctgagatggaaagacaactgggacatt
ttgatcagaaagcagtga

DBGET integrated database retrieval system