KEGG   Xenopus tropicalis (western clawed frog): 448485Help
Entry
448485            CDS       T01011                                 

Gene name
gch1
Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00790  Folate biosynthesis
xtr01100  Metabolic pathways
Module
xtr_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    448485 (gch1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     448485 (gch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF MAPKK1_Int
Motif
Other DBs
NCBI-GeneID: 448485
NCBI-ProteinID: NP_001006789
Xenbase: XB-GENE-961365
UniProt: Q6DIE0
Position
8
AA seq 247 aa AA seqDB search
MDPAKSRPLLEKKALNCNGFLREDKKEPAAAGSRGDVGRAGMSTPPVDTWREERARSEED
NELNLPSLATAYGTILRALGEDPGRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFD
EDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
RLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREE
FLTLIRS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgccaagtctcgcccactgctagaaaagaaagcgctgaactgcaacgggttc
ttacgggaggacaagaaggagccggcagcggcggggagccggggggatgtgggcagggca
ggcatgagcaccccacctgtagatacctggagagaggagagagcccgcagcgaggaggac
aacgagctcaacctgccttccctggccacagcttatggcaccatcctccgggcactggga
gaggacccaggcaggcagggcttgctcaaaaccccatggagggcagccaccgccatgcag
tatttcactaagggctaccaggaaacgatatcagatgtgctgaatgatgccatatttgat
gaagaccacgacgaaatggtgatagttaaagacattgacatgttttccatgtgtgagcat
catttagtcccattcattggaaaggtgcatataggctatctaccaaacaaacaggtgctg
ggcctcagcaagcttgccaggattgtggaaatatacagcagaagattacaagttcaagaa
cgccttacaaaacaaattgccatagcaattacagaagccttacatccctctggtgttgga
gtggttgttgaagcaacgcacatgtgcatggtaatgcgaggtgtccagaaaatgaacagt
aaaactgtaacgagtaccatgctaggggtctttcgggaagatccaaagactcgggaagag
ttcttaacactcatcagaagttga

DBGET integrated database retrieval system