KEGG   Xenopus tropicalis (western clawed frog): 448485Help
Entry
448485            CDS       T01011                                 

Gene name
gch1
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    448485 (gch1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     448485 (gch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 247 aa AA seqDB search
MDPAKSRPLLEKKALNCNGFLREDKKEPAAAGSRGDVGRAGMSTPPVDTWREERARSEED
NELNLPSLATAYGTILRALGEDPGRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFD
EDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
RLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREE
FLTLIRS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgccaagtctcgcccactgctagaaaagaaagcgctgaactgcaacgggttc
ttacgggaggacaagaaggagccggcagcggcggggagccggggggatgtgggcagggca
ggcatgagcaccccacctgtagatacctggagagaggagagagcccgcagcgaggaggac
aacgagctcaacctgccttccctggccacagcttatggcaccatcctccgggcactggga
gaggacccaggcaggcagggcttgctcaaaaccccatggagggcagccaccgccatgcag
tatttcactaagggctaccaggaaacgatatcagatgtgctgaatgatgccatatttgat
gaagaccacgacgaaatggtgatagttaaagacattgacatgttttccatgtgtgagcat
catttagtcccattcattggaaaggtgcatataggctatctaccaaacaaacaggtgctg
ggcctcagcaagcttgccaggattgtggaaatatacagcagaagattacaagttcaagaa
cgccttacaaaacaaattgccatagcaattacagaagccttacatccctctggtgttgga
gtggttgttgaagcaacgcacatgtgcatggtaatgcgaggtgtccagaaaatgaacagt
aaaactgtaacgagtaccatgctaggggtctttcgggaagatccaaagactcgggaagag
ttcttaacactcatcagaagttga

DBGET integrated database retrieval system