KEGG   Xenopus tropicalis (western clawed frog): 448500Help
Entry
448500            CDS       T01011                                 

Gene name
rpa2, repa2, rpa32, rpa34
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    448500 (rpa2)
   03420 Nucleotide excision repair
    448500 (rpa2)
   03430 Mismatch repair
    448500 (rpa2)
   03440 Homologous recombination
    448500 (rpa2)
   03460 Fanconi anemia pathway
    448500 (rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 275 aa AA seqDB search
MWNNHGGFDGGYGGSGMGGGGYMQSPGGFGSPAPTQGEKKSRSRSQQIVPCTVSQLLSAT
QNDEMFRIGEAELSQVTIVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEASCENM
VVPPGSYVKVAGHLRSFQNKKSVVAFKIAPVDDMNEFVSHMLEVVHAHMTMNSQGAPSGG
GSAVALNTPGRLGDSGGAFSGGNDNATNGLTPHQSQILNLIKSFKGNEGMAFEELKNRLH
GMNVNTIRQAVDFLSNEGHIYSTVDDEHYKSTDGD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacaaccacggtggatttgatggtgggtatggtggctctggcatgggaggagga
ggttatatgcagtctccaggaggctttgggtctcctgcacccactcagggagagaaaaaa
tcgaggtccaggtcacagcaaatagtgccatgtactgtgtcacagctactgtcagcaaca
caaaatgacgaaatgtttcggataggagaggctgaactttcacaggttactatagtcggc
attgtcaggcatgcagaaaaagctccgacaaatattctttacaaagtggatgatatgact
gcagcaccaatggatgtcagacagtgggtggacacagatgaggcaagctgtgaaaatatg
gtggtccctccagggagttatgtaaaagtagctggtcaccttcgttccttccagaacaag
aaaagtgttgttgcatttaagattgctcctgttgatgatatgaacgagtttgtttctcat
atgctggaagttgttcacgctcacatgaccatgaattcccagggagcgccttcaggaggc
ggatcagcggtggcactcaatacacctggacgccttggtgacagtggtggagcattctca
ggtggaaatgacaatgcgacaaatgggctgacgccacatcagagccagattcttaatttg
atcaaaagcttcaaaggaaacgaaggcatggcttttgaagaactgaaaaatagacttcat
ggaatgaatgtaaacacaattaggcaagctgtagattttctcagcaatgaaggacacatt
tattccactgttgatgatgaacattacaaatcaactgatggagactaa

DBGET integrated database retrieval system