KEGG   Xenopus tropicalis (western clawed frog): 448511Help
Entry
448511            CDS       T01011                                 

Gene name
pdk4, PDKe, PDKk, xPDKe, xPDKk
Definition
(RefSeq) pyruvate dehydrogenase kinase 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     448511 (pdk4)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   448511 (pdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 448511
NCBI-ProteinID: NP_001006803
Xenbase: XB-GENE-491645
UniProt: Q6DFQ9
Position
Un
AA seq 404 aa AA seqDB search
MKFARFLLKNAALANAPKQIERFSRFSPSPLSMKQFIDFGSANGCEKTSFAFLRQELPVR
LANIMRELYILPDQLLGTPSVQLVQSWYIQSLMELIEFVERNPEDQRVLSDFTEALVTIR
NRHNNVVPTMAQGVIEYKEAFGVDPVTNQNVQYFLDRFYMSRISIRMLINQHTLLFDGGT
NPAHPKHIGSIDPNCDVVEVVHDAFDTAKMLCEQYYLASPKLIIRQANGKDPTQPIHIVY
VPSHLYHMLFELFKNAMRATIENHETSSHLPPVEVNVVLGNEDLTIKISDNGGGVPLRKI
ERLFSYMYSTAPRPLMDNSRNAPLAGFGYGLPISRLYARYFQGDLMLQSMEGFGTDAVIY
LKALSTESVERLPVFNKSAWKHYKFCTEADDWCIPSSEPKNLAR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgcccggttcctattgaagaatgcagccttggcaaatgcccccaaacagatt
gagaggttcagtcgcttctccccttccccactctccatgaagcagttcatagactttggt
tctgccaatggctgtgagaagacctcctttgcattcctccgacaagagcttccagtaaga
ctggccaacatcatgagggagctctatatacttcctgaccagttgctggggacaccatcg
gtgcagcttgtccaaagctggtacatacagagcttgatggagctaatagaatttgttgaa
agaaacccggaggaccaaagagtgctgtctgatttcacagaggctctcgtgacaatccgg
aacagacacaacaatgttgtccctacaatggctcagggagttatagaatacaaggaggca
tttggagtggaccctgtcaccaatcaaaatgttcagtattttcttgatcgcttttacatg
agccgcatttctatacggatgcttataaaccagcacactcttctttttgatggaggaacc
aacccagcccacccaaaacacattggaagcattgatccaaactgtgatgtggttgaggta
gtgcatgatgcttttgacactgccaagatgctttgtgaacagtactatttagcttctccc
aagctgataataaggcaggcaaatggcaaagatcctacccagccgattcatatagtatat
gttccatcacatctctatcacatgctttttgagctttttaagaatgccatgcgggcaacg
attgaaaatcatgaaaccagttcccacctacctccagttgaagtgaatgttgtcctagga
aacgaagatcttactattaagatatcagacaacggagggggcgttcccttgcggaagatc
gaacgactgttcagttacatgtattccacagcacccaggcctctgatggataattcacgg
aatgctcctttggctggttttgggtatggattgcccatctctcgactttatgccaggtac
ttccagggtgacttaatgctgcaatcaatggagggcttcgggacagatgcagttatttat
ttaaaggcattatcaacagagtctgtagagagattacctgtattcaacaagtctgcctgg
aaacattataaattctgcactgaagcagatgattggtgcattccaagcagcgaaccaaag
aacctggcaaggtag

DBGET integrated database retrieval system