KEGG   Xenopus tropicalis (western clawed frog): 448574Help
Entry
448574            CDS       T01011                                 

Gene name
dtymk
Definition
deoxythymidylate kinase (thymidylate kinase) (EC:2.7.4.9)
Orthology
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xtr00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 216 aa AA seqDB search
MAGLRGALIVLEGADRAGKSTQARRLVEALKERGYKTEGLRFPERTTEIGRLIGSYLEKK
SNLEDHTIHLLFSANRWEQVPMIKEKLRSGVTLVIDRYAFSGVAFTSSKENFDLHWCKQP
DVGLPKPDLVLFLNVSPEVAASRGGFGNEIYETNSFQEKVSKRYAELMEDKTVNWTLIDA
SQNIEDVHRQLKELTEKAIEDAKDKPIGKLWEEESP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctggcctgcgaggtgctttaattgtgctagaaggcgcagacagagccgggaagagc
acccaggcccgacggctggtcgaggcactgaaagagcggggttacaagacggaggggctg
cgatttccagagagaacaactgaaattggacgactgattggctcctatttagagaagaag
agtaaccttgaggaccatactattcatctgttgttttctgccaaccgctgggaacaagtt
ccaatgataaaagagaagttgagaagtggtgttactctggttatagaccgatatgctttt
tctggggttgcatttacaagttctaaggagaactttgatctgcattggtgtaagcaacct
gatgttggactgccaaagccagatctggtcctctttctgaacgtgagccctgaggttgca
gcttcacgcggaggttttggaaatgagatctatgaaactaattcattccaagaaaaagta
tcaaagcgttatgctgagcttatggaagataagacagtcaactggacgctcattgatgct
tcccagaatatcgaagatgttcacagacagttaaaagagctgactgaaaaggccatagag
gatgccaaagataaaccgattggcaagctatgggaagaagaatcaccttga

DBGET integrated database retrieval system