KEGG   Xenopus tropicalis (western clawed frog): 448650Help
Entry
448650            CDS       T01011                                 

Gene name
ppt1, cln1, incl, ppt
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    448650 (ppt1)
  Lipid metabolism
   00062 Fatty acid elongation
    448650 (ppt1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    448650 (ppt1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     448650 (ppt1)
Lipid biosynthesis proteins [BR:xtr01004]
 Fatty acid synthase
  Component type
   448650 (ppt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 299 aa AA seqDB search
MAACRALTLTALLLTLCNGKTEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYV
LSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQR
CPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWH
DPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFY
RPGQSKETITLQESNLYMEDRLGLKEMEKAGRLVFLGVEGNHLQFSKEWFNKNIIPFLH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtgtagggctcttacactgacagctctgctactgactttgtgcaatgggaag
acagaagcggacccggtacctttagttatatggcacggaatgggtgattcctgttgcaat
cccttcagtatgggggcagtgaagaaaatggtggaggagcagattccaggcatatatgtt
ctttcactggagattgggaacagcatcccagaggacatgaaaaacagcttcttccttaat
gtgaacgaacaagtggatggtgtttgtaaagagctagctcaaaatcctaacctgaaaaat
ggatacaacagtatgggattttcccagggagggcagttcttgagagcagtggctcagaga
tgtccttctccacccatgaaaaacctgatttctattggaggacaacatcaaggagtctat
ggatttccacgatgtccaggagaaatttcccatatgtgtgacttgataagaaaactcctg
aattatggtgcctacactagagaagtacaagattatctggttcaagctgaatactggcat
gacccaataaatgaagagcaatacagaaacggcagtattttcctagcagacatcaatcag
gagaggcatgtgaatgtgagttacaaacagaatcttcagctgttggaaaagtttgtgatg
gtgaaatttcttaacgacaccatggtagatcctccagatacagaatggtttgggttctac
agaccaggacaaagcaaagagaccatcacattacaggagagcaatttgtacatggaggac
cgtttggggcttaaggaaatggaaaaagcaggaaggctggtgttccttggggtggaagga
aatcacctacaattctcaaaagagtggtttaacaagaatatcattccctttctgcactga

DBGET integrated database retrieval system