KEGG   Xenopus tropicalis (western clawed frog): 448677Help
Entry
448677            CDS       T01011                                 

Definition
MGC89871 protein
Orthology
K03259  
translation initiation factor 4E
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    448677
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    448677
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    448677
Translation factors [BR:xtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    448677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 234 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENGTQKDSEKEKNEKEKNQGSSRKKSVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTVMEYKTHTDSIKDKTSFRNTKIAL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgatgctctaaaagatgacgacagtggggatcatgatcagaacgag
gaaaatggcacacagaaagacagtgagaaggaaaaaaatgagaaggaaaaaaaccaaggc
tcttctaggaaaaagagtgttgtgccaggtccagccgagcaccccttacagtacaactac
acattttggtactcacgcagaactccaggaaggccaaccagctcccagagctatgagcag
aacattaaacagatcggtacctttgcttctgtggaacagttttggaggttctatagtcac
atggtacgtcctggggacctgactgggcacagtgactttcacctcttcaaggaagggatt
aaaccaatgtgggaggatgatgcaaacaaaaatggagggaagtggataattcgccttcgc
aaaggcctagcatcacgatgctgggaaaatctcatactggccatgctgggagagcagttt
atggttggagaggagatctgtggggctgttgtctctgtgcgttttcaggaagacatcata
tctatttggaacaaaactgcaagtgatcaggcaaccactgctcgtattcgagacacattg
cggcgagtcctgaatttgcctcccaacactgttatggaatacaaaacgcacacagacagc
atcaaggacaaaacaagcttcagaaataccaaaattgctttgtga

DBGET integrated database retrieval system