KEGG   Xenopus tropicalis (western clawed frog): 448733Help
Entry
448733            CDS       T01011                                 

Gene name
hist1h2bk
Definition
(RefSeq) histone cluster 1, H2bk
  KO
K11252  histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    448733 (hist1h2bk)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   448733 (hist1h2bk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 448733
NCBI-ProteinID: NP_001006891
Xenbase: XB-GENE-5719555
UniProt: Q6AZK7
Position
9
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccagccaagtccgctccagccccgaagaaaggctccaagaaagcggtgacc
aagacccagaagaaagatgggaagaagcgcaggaagacaaggaaggagagttacgccatt
tacgtgtacaaggtgctgaagcaggtgcaccccgataccggcatctcctccaaggccatg
agcatcatgaactcctttgtcaacgatgtgtttgagcgcatcgcaggggaagcctcccgc
ctggctcattacaacaagcgctccaccatcacctcccgggagatccagaccgcggtccgc
ctgctgctgcctggggagctggccaagcacgccgtgtccgagggcaccaaggctgttacc
aagtacaccagcgccaagtaa

DBGET integrated database retrieval system