KEGG   Xenopus tropicalis (western clawed frog): 448733Help
Entry
448733            CDS       T01011                                 

Gene name
hist1h2bk
Definition
histone cluster 1, H2bk
Orthology
K11252  
histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   448733 (hist1h2bk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccagccaagtccgctccagccccgaagaaaggctccaagaaagcggtgacc
aagacccagaagaaagatgggaagaagcgcaggaagacaaggaaggagagttacgccatt
tacgtgtacaaggtgctgaagcaggtgcaccccgataccggcatctcctccaaggccatg
agcatcatgaactcctttgtcaacgatgtgtttgagcgcatcgcaggggaagcctcccgc
ctggctcattacaacaagcgctccaccatcacctcccgggagatccagaccgcggtccgc
ctgctgctgcctggggagctggccaagcacgccgtgtccgagggcaccaaggctgttacc
aagtacaccagcgccaagtaa

DBGET integrated database retrieval system