KEGG   Xenopus tropicalis (western clawed frog): 493237Help
Entry
493237            CDS       T01011                                 

Gene name
ugp2
Definition
UDP-glucose pyrophosphorylase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    493237 (ugp2)
   00052 Galactose metabolism
    493237 (ugp2)
   00500 Starch and sucrose metabolism
    493237 (ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    493237 (ugp2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     493237 (ugp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 508 aa AA seqDB search
MTSFPGGLRNAMAGGGMLQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPDNIASVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSH
CRVKIHTFNQSRYPRISKESLLPIAKDLSYSVENAETWYPPGHGDIYASFYNSGLLDRLI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKCEFVMEVTDKTRADVKGGTLTQCEG
KLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSE
KREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctttccgggaggattaaggaacgcaatggcgggtggaggcatgttacagttc
caggaggccatccgagaggagctggaagaagccatgaagtcagacttggaaaaaattctt
tccacggcccctgaatcagaattagagcacataaagaaagaccttgctggttttcagaaa
ttattccacagatttctacaggaaaaaggtccatcagtggactggggaaagatccagaga
cctccagaggattctattcagccatacgagaagataaaggcaaaaggccttccagataac
atagcttcggtcctgaacaagctggttgtggtaaagcttaatggcggtttgggtacaagc
atgggctgcaaaggtcccaaaagcctgattggcgttcgtaatgagaatactttcctagat
cttactgtgaagcaaatagagcacttgaatacagtatacaacacagatgttccccttgtc
ctgatgaactctttcaacacagatgaagataccaagaagatcctacagaagtacagtcac
tgtcgagtgaagattcatacttttaatcagagcaggtacccaaggataagtaaggagtca
ctattgcccattgccaaagacttgtcctattctgtggaaaatgctgagacgtggtacccc
cctggtcatggtgatatctatgccagcttttataattccggcctcctagacaggctcata
ggggaagggaaggagtacatctttgtttccaacattgacaatcttggggccacagtggac
ctatatatccttaatcatctcatgaatccaccaaatggcaagaaatgtgaatttgtcatg
gaggtgactgacaaaacgagggctgatgtcaagggtgggaccctcactcagtgcgaaggg
aaactgaggctggtggaaattgcccaagtgccaagagcccatgtagatgagtttaaatct
gtctccaagtttaagatctttaacacaaataatttgtggatttccttatctgcaatcaag
aggctgcaagaagccaatgccatagatatggaaatcattgttaatcccaagacgttggat
ggaggattaaatgttattcagctggagacggctgttggagcagctattaaaagttttgaa
aattctttgggtatcaatgttcctcgaagccgtttccttcctgtcaagaccacgtcagac
cttctgcttgtcatgtccaacctgtacagccttcatgccggctccctgaccatgagcgag
aagcgtgagttccccaccgtcccactcaccaaactgggaagctccttcacaaaggtacaa
gactatttgaagagatttgaaagtattccggatatgctggaactggatcacctcaccgtg
tccggagatgtcacgtttgggaagaatgtggtactgaagggtactgtgattataattgca
aaccacggagatagaatcgacatacctcccggggcagtattagaaaacaagattgtgtct
ggaaacctgcggatcctggatcactga

DBGET integrated database retrieval system