KEGG   Xenopus tropicalis (western clawed frog): 493341Help
Entry
493341            CDS       T01011                                 

Gene name
pdia6, erp5, pdia6-a, pdia6-b, pdip5, txndc7
Definition
(RefSeq) protein disulfide isomerase family A member 6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    493341 (pdia6)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     493341 (pdia6)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   493341 (pdia6)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    493341 (pdia6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 OST3_OST6 Thioredoxin_3 Thioredoxin_9
Motif
Other DBs
NCBI-GeneID: 493341
NCBI-ProteinID: NP_001007974
Xenbase: XB-GENE-974680
UniProt: Q66KA7
Position
5
AA seq 441 aa AA seqDB search
MARAVLGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTA
DAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSKKDVIDLTDDTFDKNVLNSDD
VWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPT
IKIFQKGEDPVDYDGGRTKPDIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIV
AVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAM
AAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGEL
PAEDDIDLSDVELDDFEKDEL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccagggcagttcttggtgcagtggcctgcacactgtttatggctgcaagtgccatg
tactcacccagtgacgatgtgatcgagttgacacccagcaactttaataaagaagttatc
cagagtgacagtttatggcttgtggagttttatgccccctggtgtggacactgccagagg
ctgaccccagactggaagaaagccgccacggcattaaagggagtggtgaaaattggagct
gttaatgctgatcagcatcagtcactgggtgggcagtatggagtgcgaggctttccaaca
atcaaagtatttggagcgaataagaacaaaccagatgattatcaaggtggaaggacagcc
gatgccattatcgatgccgcattaagctcacttcgttcatttgttaaggacaggcttgga
ggaaggagcggtggatctgattcaggaaggcagagctatagcagcggtggtgggagtaaa
aaagacgttattgatctgacggacgacacatttgataagaatgtactgaatagcgatgat
gtgtggtttgttgaattttatgctccatggtgtggccattgcaaaaatctagagcctgaa
tgggccgctgctgccacagagattaagcaacaaaccaatggaaaagtaaagttggctgcc
gtagatgccactgtcagccaggtgttggccagtcgttatgggataagaggcttccccaca
attaagatattccaaaaaggcgaagatcctgtggattatgatggtggaaggactaagcca
gacattgttgcccgtgcaattgatctgttctcagagaatgctccaccccctgagatttat
gagatcctgaatggagatatagtgaagaagacctgcgatgagcatcagttgtgtattgtt
gccgtattgccacatatccttgacacaggtgcttctggaagaaattcttacttggacgta
atgatgaaaatggcagacaagtacaaaaagaaaatgtgggggtggctgtgggctgaggct
ggcgctcagatggatctggaaacctcactgggaattggaggctttgggtaccctgccatg
gctgccatcaatgcaagaaaaatgaaatttgcacttctgaaaggttccttcagcgagcag
ggcattaatgaattcttaagggagctctcttttggtcgtggttctacatcacctgtgggt
ggaggagcaattcctaaaatcaatacagtggtaccttgggatggaaaagatggagagctg
ccagcagaggatgatattgatctgagtgatgtggagctggatgactttgagaaagatgaa
ttgtga

DBGET integrated database retrieval system