KEGG   Xenopus tropicalis (western clawed frog): 493341Help
Entry
493341            CDS       T01011                                 

Gene name
pdia6, erp5, pdip5, txndc7
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xtr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 441 aa AA seqDB search
MARAVLGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTA
DAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSKKDVIDLTDDTFDKNVLNSDD
VWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPT
IKIFQKGEDPVDYDGGRTKPDIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIV
AVLPHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAM
AAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVGGGAIPKINTVVPWDGKDGEL
PAEDDIDLSDVELDDFEKDEL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccagggcagttcttggtgcagtggcctgcacactgtttatggctgcaagtgccatg
tactcacccagtgacgatgtgatcgagttgacacccagcaactttaataaagaagttatc
cagagtgacagtttatggcttgtggagttttatgccccctggtgtggacactgccagagg
ctgaccccagactggaagaaagccgccacggcattaaagggagtggtgaaaattggagct
gttaatgctgatcagcatcagtcactgggtgggcagtatggagtgcgaggctttccaaca
atcaaagtatttggagcgaataagaacaaaccagatgattatcaaggtggaaggacagcc
gatgccattatcgatgccgcattaagctcacttcgttcatttgttaaggacaggcttgga
ggaaggagcggtggatctgattcaggaaggcagagctatagcagcggtggtgggagtaaa
aaagacgttattgatctgacggacgacacatttgataagaatgtactgaatagcgatgat
gtgtggtttgttgaattttatgctccatggtgtggccattgcaaaaatctagagcctgaa
tgggccgctgctgccacagagattaagcaacaaaccaatggaaaagtaaagttggctgcc
gtagatgccactgtcagccaggtgttggccagtcgttatgggataagaggcttccccaca
attaagatattccaaaaaggcgaagatcctgtggattatgatggtggaaggactaagcca
gacattgttgcccgtgcaattgatctgttctcagagaatgctccaccccctgagatttat
gagatcctgaatggagatatagtgaagaagacctgcgatgagcatcagttgtgtattgtt
gccgtattgccacatatccttgacacaggtgcttctggaagaaattcttacttggacgta
atgatgaaaatggcagacaagtacaaaaagaaaatgtgggggtggctgtgggctgaggct
ggcgctcagatggatctggaaacctcactgggaattggaggctttgggtaccctgccatg
gctgccatcaatgcaagaaaaatgaaatttgcacttctgaaaggttccttcagcgagcag
ggcattaatgaattcttaagggagctctcttttggtcgtggttctacatcacctgtgggt
ggaggagcaattcctaaaatcaatacagtggtaccttgggatggaaaagatggagagctg
ccagcagaggatgatattgatctgagtgatgtggagctggatgactttgagaaagatgaa
ttgtga

DBGET integrated database retrieval system