KEGG   Xenopus tropicalis (western clawed frog): 493461Help
Entry
493461            CDS       T01011                                 

Gene name
apoa4, myh11
Definition
apolipoprotein A4
Orthology
K08760  
apolipoprotein A-IV
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MLLKVTTLALVLCAITGSQADVRTDQAVSAFWDYVSQLQSSTKDTVDQIQQSDITKQLNV
LIQDKMKSMNLYAGELQSQVIPFAKQIHDQLTQDSEKIREQIQQELEQLRVKISPYADEV
HKQVNKNLEELQLKLTPYAEELKSQLEKNTNTISQQLRSVVQEMDSKIRDNAGNLQESLA
PYSEKLQAQIDESVDQLRKQLNPYTDEVRDKIGHQVQKLRESLSPYAEEMQENLAKQIES
MEFQMRKSVEQADTQLKQITEQLKAQLSPYADDLKEKLQVNARDAKQTLEPYLTELNQQM
EQKIAEFKVSITPYGEALNKALVQRVEDMKLKFGKYTVTVQDQMEYLEKDIRDKFSDFIN
KGITETEN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgaaggtgacaaccctcgctctggttttatgtgccatcacaggctcccaagcc
gatgtcagaacagaccaagcagtcagtgctttctgggactatgtctcccagctgcaaagc
agcaccaaggatacggtggaccagatccagcagtcagatatcaccaaacaacttaatgtt
ctcatacaggataaaatgaaaagtatgaacctttatgctggagaactacaaagccaagta
attccctttgcaaagcaaatccatgaccaactaacacaagattcagagaaaattcgagag
cagatacaacaggagctggagcagctcagggtgaagatttctccttacgcagatgaagta
cataaacaagtgaacaagaatttggaggagctgcagctcaaactgactccttatgctgag
gaactgaaaagccaactagagaagaacactaacacaatcagtcagcaacttaggtctgta
gttcaagaaatggattctaagattagggacaatgcaggaaatttgcaagaatctttggca
ccatattcagaaaaactccaggcccaaatagatgagagtgtagaccaactaagaaaacaa
cttaacccttacactgatgaagtgagagataagattggccatcaagtacaaaagttacgt
gagagcctgagcccttatgcagaggagatgcaggagaatttagccaagcagatagagagc
atggaattccaaatgagaaagagtgttgagcaagcagacacccaattaaaacagatcact
gagcagttaaaagctcaactgagcccctatgcagatgatctgaaagagaaactccaggta
aatgctagggatgctaagcagacactagaaccatatctcaccgagctaaaccagcagatg
gagcagaagattgcagaatttaaagttagcatcactccctatggagaggcactcaacaag
gcactagtgcagagggtagaggacatgaaactgaaatttgggaaatacacagtgactgtg
caagatcaaatggaatacttagaaaaagacatccgagataagtttagcgacttcataaat
aaaggtataactgaaactgaaaactaa

DBGET integrated database retrieval system