KEGG   Xenopus tropicalis (western clawed frog): 493461Help
Entry
493461            CDS       T01011                                 

Gene name
apoa4, myh11
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein DUF883 YtxH ApoLp-III Baculo_PEP_C ApoO Phage_Mu_Gam Mitofilin SF-assemblin DUF5324 Prominin DUF4455 DUF1845 DUF885 Toxin_trans Phasin Gp58 KapB Exonuc_VII_L Senescence BshC DUF3584 Fzo_mitofusin DUF4456 Spore_III_AB GTSE1_N Apo-CIII
Motif
Other DBs
NCBI-GeneID: 493461
NCBI-ProteinID: NP_001008099
Xenbase: XB-GENE-941908
UniProt: Q66IL6
Position
7
AA seq 368 aa AA seqDB search
MLLKVTTLALVLCAITGSQADVRTDQAVSAFWDYVSQLQSSTKDTVDQIQQSDITKQLNV
LIQDKMKSMNLYAGELQSQVIPFAKQIHDQLTQDSEKIREQIQQELEQLRVKISPYADEV
HKQVNKNLEELQLKLTPYAEELKSQLEKNTNTISQQLRSVVQEMDSKIRDNAGNLQESLA
PYSEKLQAQIDESVDQLRKQLNPYTDEVRDKIGHQVQKLRESLSPYAEEMQENLAKQIES
MEFQMRKSVEQADTQLKQITEQLKAQLSPYADDLKEKLQVNARDAKQTLEPYLTELNQQM
EQKIAEFKVSITPYGEALNKALVQRVEDMKLKFGKYTVTVQDQMEYLEKDIRDKFSDFIN
KGITETEN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgaaggtgacaaccctcgctctggttttatgtgccatcacaggctcccaagcc
gatgtcagaacagaccaagcagtcagtgctttctgggactatgtctcccagctgcaaagc
agcaccaaggatacggtggaccagatccagcagtcagatatcaccaaacaacttaatgtt
ctcatacaggataaaatgaaaagtatgaacctttatgctggagaactacaaagccaagta
attccctttgcaaagcaaatccatgaccaactaacacaagattcagagaaaattcgagag
cagatacaacaggagctggagcagctcagggtgaagatttctccttacgcagatgaagta
cataaacaagtgaacaagaatttggaggagctgcagctcaaactgactccttatgctgag
gaactgaaaagccaactagagaagaacactaacacaatcagtcagcaacttaggtctgta
gttcaagaaatggattctaagattagggacaatgcaggaaatttgcaagaatctttggca
ccatattcagaaaaactccaggcccaaatagatgagagtgtagaccaactaagaaaacaa
cttaacccttacactgatgaagtgagagataagattggccatcaagtacaaaagttacgt
gagagcctgagcccttatgcagaggagatgcaggagaatttagccaagcagatagagagc
atggaattccaaatgagaaagagtgttgagcaagcagacacccaattaaaacagatcact
gagcagttaaaagctcaactgagcccctatgcagatgatctgaaagagaaactccaggta
aatgctagggatgctaagcagacactagaaccatatctcaccgagctaaaccagcagatg
gagcagaagattgcagaatttaaagttagcatcactccctatggagaggcactcaacaag
gcactagtgcagagggtagaggacatgaaactgaaatttgggaaatacacagtgactgtg
caagatcaaatggaatacttagaaaaagacatccgagataagtttagcgacttcataaat
aaaggtataactgaaactgaaaactaa

DBGET integrated database retrieval system