KEGG   Xenopus tropicalis (western clawed frog): 493538Help
Entry
493538            CDS       T01011                                 

Gene name
cyct, cycs
Definition
cytochrome c, testis
Orthology
K08738  
cytochrome c
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    493538 (cyct)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    493538 (cyct)
   04115 p53 signaling pathway
    493538 (cyct)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    493538 (cyct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKSTSE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgttgaaaagggaaagaagatctttgtccagaagtgcgcacagtgccacaca
gtcgaaaagactggaaaacataagactgggccgaacctgtggggcctcttcggccgtaaa
actggacaagccccaggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaagataccctgtttgaatatttggagaacccaaagaaatatattcctggaaccaaa
atgatttttgctggcattaaaaagaagaatgagcgcgcagatctgatagcctatctaaag
aagtccacgtcagagtga

DBGET integrated database retrieval system