KEGG   Xenopus tropicalis (western clawed frog): 493568Help
Entry
493568            CDS       T01011                                 

Gene name
bap1, hucep-13, hucep-6, uchl2
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Ensembl: 
UniProt: 
Position
Un
AA seq 685 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCPGPVYGFIFLFKWIEERRSRR
KVSTLLDDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNCSGVHLGPTLSRIKEFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLK
YESKLHILKMNRQTVLEALQQLIRVTQPELIQAQKPTEGQSTEETKSAALKAPVSQESHR
AHHGSHRNATDVGAEPPGALIRGPVMSAYSKPNSLAQNGGTVAAPASRLPAFLDNHNYAK
SPMQEEEDLAAGVGRSRGVPPPAPDTDEEEEEETENVRRPLTPPGFKRRSSEPLPPPPGP
EPGVLAEKLKETQRDLCSPLSIKTGAPTAPHSQPSPTPSNESTDTASEIGSAFNSPLRSP
LRSANPTRPSSPVTLHLSKVLFGEEEPLLRLDCVRYNRAVRELGPHISTGILHLSKDGYL
CPLSRLETGKVSPKGNKVEEPRESSEPDTERSRVTEVPQGEKFSPKELLALLKCVEAEIS
SSEACLREELEKRKKFKIDDQRRTHNYDEFICAFISMLAQEGMLASLVEQNISVRRRQGV
SIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggctggctagagctggaaagcgatccaggactttttaccctgctggttgaa
gattttggtgtaaaaggggtgcaggttgaggagatctatgaccttcagagcaagtgccca
gggccagtctatggctttatctttctattcaaatggatagaggagcgtcgatcgcgcagg
aaagtctccactttgctggatgatacctccgttatggaagatgaagttgtcaacaacatg
ttctttgcccatcagctgatccctaattcatgtgctacccacgcccttctgagtgtgttg
ctgaactgtagtggggttcacctggggcccacactgagccgcatcaaggaattcaccaaa
ggattcagcccagagagcaaagggtatgcaattgggaatgctccggaactggcaaaagct
cacaacagccatgccagaccagagccccgtcacctgcctgagaagcagaatgggatcagt
gctgtccgcaccatggaagcttttcactttgtcagttatgttcctattaaaggacggctt
tttgagcttgatggccttaaagtctaccctattgaccatggcccctgggcagaggatgaa
gaatggacagacaaggctcgcagagtgatcatggagaggatcggactggctacagcaggg
gagccgtatcatgacattaggtttaacctgatggcagtggtgccagatcgaaggctaaaa
tatgagagcaagcttcacattttaaagatgaacagacagactgtgctggaagcattgcaa
cagttgataagagtaactcagccagaactaattcaggcccagaagcctacggagggccag
agcacagaagaaacaaagagtgctgctctgaaggctccagtatcccaggagagccaccgg
gcacaccatggatcccatagaaatgccacagacgtcggtgcagagccacccggggcgcta
atccgaggccctgttatgtctgcgtatagtaaacccaactccctagcccagaatggtggt
actgtagctgcaccggcttcaagactgccagccttccttgataaccataactatgccaag
tcacccatgcaggaggaggaagacttggctgctggggtgggcaggtcgcggggtgtccct
ccacctgctccagacacagatgaagaggaagaagaggaaactgagaatgttagaagacct
ctcacacctccggggttcaagagaagaagttcagagcctttgcctcccccgccagggcct
gaacctggtgttttggcagagaaactaaaagagacacagagggatttgtgctcccccctt
tctataaagacaggagcccctactgctccccactctcagccttcccctactccaagcaat
gaaagcacagacactgcctcagaaattggtagtgctttcaactcaccacttcgttctcct
ttaagatctgccaacccaacccgtccttccagtcctgttaccttgcatctctccaaagtt
ctctttggtgaggaggaaccacttctgcgccttgactgtgtgcgctataacagagcagtg
agggaactgggaccacatatcagcactgggattctgcatttgagcaaggatgggtacctg
tgcccactcagcaggctggaaacaggtaaagtatcccccaagggcaacaaagtagaggag
ccaagagagagttccgagccagacacagagcgcagcagagtcacagaagttccacaaggg
gaaaaattctctcctaaggagctgctagcattgctgaagtgtgttgaagccgaaatctct
tcatccgaagcctgtctgagggaagaactagagaaacgcaaaaaatttaagattgatgac
caaagacggactcataactatgacgaatttatctgtgcattcatctcaatgttggctcag
gaagggatgctggcaagcttggtggagcagaatatctctgtgcggagacgtcagggggtc
agcattggccgactgcacaaacagaggaagcctgaccggcgcaagcgatcccgcccttac
aaggccaagagacagtag

DBGET integrated database retrieval system