KEGG   Xenopus tropicalis (western clawed frog): 496407Help
Entry
496407            CDS       T01011                                 

Gene name
cyp2a6, cyp2a13
Definition
cytochrome P450, family 2, subfamily A, polypeptide 6
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    496407 (cyp2a6)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     496407 (cyp2a6)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP2 family
   496407 (cyp2a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 494 aa AA seqDB search
MDTSWLWTLLLCLLISAMLIYSTWNKMYRKRNLPPGPTPIPLFGNVMQIKRGEMVKSLIE
LGKKYGDIYTLYFGPSPVVILCSYRAIKEALIDQAEEFSGRGAIPSFDQYFQGYGVVFTN
GEEWKNLRRFSLSTLRNFGMGKRGIEERIKEEAQFLVAEIKSYKEKPFDPTNILVQCVSN
VICSVVFGNRFEYANKDFQNLLSLFQSVFQETSSSWGQLLNMLPAVMNHVPGPHKNIIRD
MNKLEDFVLQRVKENEKTVDPNSPRDLIDSFLIKMQQENKNPTSPFHMKNLIATILSIFF
AGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNRSPTIEDRNKMPYTDAVIHEIQ
RLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAVLRDPEQFDTPSKFNPNHFLDDK
GCFKSNDGFMPFSTGKRICLGEGLARMELFLFLTNILQNFKLHSESGLTEDNIAPKMKGF
ANYPTSYQLSFIPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcatggttgtggacgcttctactgtgtttgctaatctctgccatgttaatc
tattctacctggaacaaaatgtatagaaagcgtaacctccctccaggacccacacctatc
cctctctttggaaatgttatgcagatcaaaaggggggagatggttaaatcattaattgag
cttggaaaaaaatatggcgatatctacactctctactttggccccagtcctgttgtcatt
ttgtgcagctaccgggcaataaaagaggctcttattgaccaggcagaagagttcagtggt
cgtggtgcaattccaagttttgatcaatatttccaagggtatggtgtagtttttactaat
ggagaagaatggaagaacctgagacgattttccctttcaacactaaggaattttggaatg
ggaaagagaggcattgaagaaaggattaaggaagaagcacagttcctggtggcagagatt
aagtcatacaaagagaaaccttttgatccaaccaatatcttggtccaatgtgtgtccaat
gtaatctgctctgttgtttttgggaatcgttttgaatatgccaacaaggattttcagaat
ctcctttccctgtttcaatctgtcttccaagaaaccagctcttcctggggtcagttgctg
aatatgctgccagccgtcatgaatcatgtcccaggtcctcataaaaatattataagggac
atgaataaactggaagattttgttttacaaagggtgaaagagaatgaaaaaactgtggat
cccaactcaccgagagaccttattgacagctttctcataaaaatgcagcaggaaaacaaa
aatcccacttctcccttccatatgaagaatttaatcgctactattctgagcatattcttt
gctggaacagagacagtaagcaccaccctaagacatggatttctcatacttctcatacat
cctgaaatagaagcaaaactacaagaggagattgacagagtggttggtcaaaatcgcagc
ccgaccattgaggacaggaacaagatgccttacacagatgctgtgatccatgagatccag
agacttagtgatgtaatcccaatgaatgtcccccatttagtcacgaaagacacaaaattc
agaggatacacaattcccaagggtactaatatctaccccttgctttgtgctgttcttcgg
gatcctgagcaatttgacactccgtccaaatttaatcctaatcactttttagatgacaag
ggctgttttaagagtaatgatggcttcatgcctttttctacagggaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctcttcctaaccaacattttacagaacttc
aagttacattcagaatctgggttaacagaagacaacatcgcccccaaaatgaaaggtttt
gccaattacccaacatcttatcaactttcatttattccacgttga

DBGET integrated database retrieval system