KEGG   Xenopus tropicalis (western clawed frog): 496407Help
Entry
496407            CDS       T01011                                 

Gene name
cyp2a6, cyp2a13
Definition
cytochrome P450, family 2, subfamily A, polypeptide 6
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xtr00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 494 aa AA seqDB search
MDTSWLWTLLLCLLISAMLIYSTWNKMYRKRNLPPGPTPIPLFGNVMQIKRGEMVKSLIE
LGKKYGDIYTLYFGPSPVVILCSYRAIKEALIDQAEEFSGRGAIPSFDQYFQGYGVVFTN
GEEWKNLRRFSLSTLRNFGMGKRGIEERIKEEAQFLVAEIKSYKEKPFDPTNILVQCVSN
VICSVVFGNRFEYANKDFQNLLSLFQSVFQETSSSWGQLLNMLPAVMNHVPGPHKNIIRD
MNKLEDFVLQRVKENEKTVDPNSPRDLIDSFLIKMQQENKNPTSPFHMKNLIATILSIFF
AGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNRSPTIEDRNKMPYTDAVIHEIQ
RLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAVLRDPEQFDTPSKFNPNHFLDDK
GCFKSNDGFMPFSTGKRICLGEGLARMELFLFLTNILQNFKLHSESGLTEDNIAPKMKGF
ANYPTSYQLSFIPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcatggttgtggacgcttctactgtgtttgctaatctctgccatgttaatc
tattctacctggaacaaaatgtatagaaagcgtaacctccctccaggacccacacctatc
cctctctttggaaatgttatgcagatcaaaaggggggagatggttaaatcattaattgag
cttggaaaaaaatatggcgatatctacactctctactttggccccagtcctgttgtcatt
ttgtgcagctaccgggcaataaaagaggctcttattgaccaggcagaagagttcagtggt
cgtggtgcaattccaagttttgatcaatatttccaagggtatggtgtagtttttactaat
ggagaagaatggaagaacctgagacgattttccctttcaacactaaggaattttggaatg
ggaaagagaggcattgaagaaaggattaaggaagaagcacagttcctggtggcagagatt
aagtcatacaaagagaaaccttttgatccaaccaatatcttggtccaatgtgtgtccaat
gtaatctgctctgttgtttttgggaatcgttttgaatatgccaacaaggattttcagaat
ctcctttccctgtttcaatctgtcttccaagaaaccagctcttcctggggtcagttgctg
aatatgctgccagccgtcatgaatcatgtcccaggtcctcataaaaatattataagggac
atgaataaactggaagattttgttttacaaagggtgaaagagaatgaaaaaactgtggat
cccaactcaccgagagaccttattgacagctttctcataaaaatgcagcaggaaaacaaa
aatcccacttctcccttccatatgaagaatttaatcgctactattctgagcatattcttt
gctggaacagagacagtaagcaccaccctaagacatggatttctcatacttctcatacat
cctgaaatagaagcaaaactacaagaggagattgacagagtggttggtcaaaatcgcagc
ccgaccattgaggacaggaacaagatgccttacacagatgctgtgatccatgagatccag
agacttagtgatgtaatcccaatgaatgtcccccatttagtcacgaaagacacaaaattc
agaggatacacaattcccaagggtactaatatctaccccttgctttgtgctgttcttcgg
gatcctgagcaatttgacactccgtccaaatttaatcctaatcactttttagatgacaag
ggctgttttaagagtaatgatggcttcatgcctttttctacagggaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctcttcctaaccaacattttacagaacttc
aagttacattcagaatctgggttaacagaagacaacatcgcccccaaaatgaaaggtttt
gccaattacccaacatcttatcaactttcatttattccacgttga

DBGET integrated database retrieval system