KEGG   Xenopus tropicalis (western clawed frog): 496408Help
Entry
496408            CDS       T01011                                 

Gene name
cyp2f2
Definition
Cyp2f2 protein
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    496408 (cyp2f2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     496408 (cyp2f2)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP2 family
   496408 (cyp2f2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 501 aa AA seqDB search
MDTTWLWSLQLFLLIATMLIYSTWNKMYRKRNLPPGPTPIPLFGNVLQIKRGEMVKSLLE
LGKKYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSGRGKIPSWDQFFQGYGESFSN
GDEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFLVAEIKSYKGKPFDPTKILVQCVSN
VICSVVFGQRYEYSNKDFHKLLYMFQAVFEDTSSTLGQLMTLLPNIMNHIPGPHKTVVNK
LNKVNDFILQRVKENEKTLDPNSPRHFIDSFLIQMQKEKDNPVTKFHWKNLLCTIMNLFF
AGTETVSTTLRHGFLMLLIHPEIEEKLHEEIDRVVGQDRSPTIEDRSKMPYTDAVIHEIQ
RFSDVLPMSLPHLVMKDTQFRGYTIPKGTDVYPLICAALRDPKQFATPNKFNPQHFLDDN
GLFKSSNAFLPFSTGKRICLGEGLARMELFLFLTNILQNFKLHSENQFAEDDIAPKMNGF
ANYPLSYEFSLIPRVQSLLVL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggatacaacatggttgtggagcctgcaactgtttctgctgatcgccaccatgttaatc
tattctacctggaacaaaatgtatagaaagcgtaacctccctccaggacccactcctatc
cctctgtttggaaatgttctgcagatcaaaaggggggagatggtcaaatctttactagag
cttggaaagaaatatggtcctgtatacaccctctactttggccccagccctgttataatc
ctgtgtgattaccagtcaataaaagaagccttaaatgaccaagcagaagagttcagcggt
cgtgggaaaataccttcttgggatcaatttttccaaggatatggggaatcttttagtaat
ggagatgaatggaagcagctgagacgtttttcccttacaacactaaggaactttggtatg
ggaaagagaggcattgaagaaagaatacaagaagaagcacagttcctggtagctgagatt
aagtcatacaaaggaaaaccttttgacccaaccaaaatcttagtccaatgcgtgtccaat
gttatctgctctgttgtgtttggccaacggtatgaatactccaacaaggatttccataaa
ctgctgtacatgtttcaagctgtatttgaagatacaagttccaccttgggtcagctgatg
accttgttgccaaatattatgaaccatataccaggccctcacaagacagtagtaaataaa
ttgaataaagtgaatgatttcattttacaaagagtgaaagagaatgagaagactttggat
cccaactcaccaagacacttcattgacagtttccttatccaaatgcagaaggagaaggat
aatcctgtgaccaaatttcactggaagaatttgctatgcactattatgaacttatttttt
gctgggacagaaacagttagtacgacccttagacatggattccttatgcttctgatacat
cccgaaatagaagaaaagttgcatgaggaaattgaccgtgtggttggacaagaccgcagc
ccgaccattgaggacaggagcaagatgccttacaccgatgctgtgatccatgaaatacag
agatttagtgatgtactcccaatgagtcttccacatttagtaatgaaagatacacaattc
agaggctacactattcccaagggtactgatgtctaccccttgatctgcgctgctctacgg
gatcctaagcagtttgctactcccaataaatttaatccccaacattttttggatgacaac
ggcctatttaagagcagcaatgcctttttgccattttctacaggcaagcggatctgcctt
ggagaaggtttggctcggatggaactctttctttttttaaccaacattctacagaacttc
aagctgcattcagaaaaccagtttgcggaagatgacattgctccaaaaatgaatggattt
gccaattatccactttcttatgaattttcgcttattccacgtgttcaatctcttttagtt
ttataa

DBGET integrated database retrieval system