KEGG   Xenopus tropicalis (western clawed frog): 496436Help
Entry
496436            CDS       T01011                                 

Gene name
aldh1l1, FDH, fthfd
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    496436 (aldh1l1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     496436 (aldh1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGREVYRELLKEGHQVVGVFTIPDKNGKADPLGADAEKDGIPVFKFPRWR
VKGQAIPEVVEKYKALEAELNVLPFCSQFIPMEVIDCPKHGSIIYHPSILPRHRGASAIN
WTLMQGDKIGGFTIFWADDGLDTGDILLQRECEVLPDDTVNTIYNRFLFPEGVKGMVEAV
RLIAEGNAPRIKQATEGATYDPMQKKENAKINWDQPAEAIHNFIRGNDKVPGAWTVVGDQ
QLTFFGSSFISNGPAPDGQPLEIPGAFRPAVVTKTGLVLFGNDGQKLSVKNIQFEDGKMI
PASQYYKTADSAALQLSDEEKKFSEEIRAAWKRILTNVSEIEDSTDFFKAGAASMDVVRL
VEEVKLKCNGLQLQNEDVYMATKFEEFIQMVVRRLRGEDGEEELVVDYVEKEINNMTVKI
PHQLFINGQFIDAEGGKTYDTVNPTDGTAICKVSLAQVSDIDRAVAAAKEAFENGEWGKM
NPRDRGRILYRLADIMEEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTFTRREPIGVCGIVIPWNYPLMMLAWKTAACLAAGNTVVLKPAQ
VTPLTALKFAELSVKAGIPKGVINILPGAGSLIGQRLSDHPDVRKIGFTGSTPIGKHIMK
SCAVGNVKKVSLELGGKSPLIIFQDCDLDKAVRMGMSSVFFNKGENCIAAGRLFLEESIH
DEFVKRVVGEVKKMKIGDPLDRSTDHGPQNHKAHLDKLIEYCQTGVKEGAKLVYGGKQVE
RPGFFFEPTIFTDVTDEMFIAKEESFGPIMIISKFKDGDVDEVLKRANNTEFGLASGVFT
KDISKALYVSEKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLKTKAVTI
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtgatcggtcaaagtctgtttggcagagaagtttacagggagttgctg
aaagaaggacaccaggtggttggagtattcactatcccagacaaaaatggcaaagcagat
cctcttggtgctgatgctgagaaggatggaatacctgtcttcaagttcccacgttggagg
gtaaaagggcaggccattccggaagtagtagaaaagtataaggcactggaggccgagctc
aacgtccttcctttctgctcccagttcattccaatggaagtcattgactgcccaaaacat
ggctccatcatctatcatccctctatccttcccaggcacaggggggcctctgcaatcaac
tggacactaatgcaaggagacaagatagggggctttaccatattctgggctgacgatggg
ctagacacgggggacatcttgctgcagagagagtgtgaggtcctccctgatgatactgtg
aacacaatttacaacagattcctcttccctgaaggagtgaaaggaatggtggaagctgtt
cgcctcattgcagagggtaatgccccgaggataaaacaggcaactgaaggagccacgtat
gatccgatgcagaagaaagagaatgcaaagattaactgggaccagccggcagaagccatc
cacaactttatcagagggaatgataaggtgcctggagcttggacagtagtgggtgatcag
caactgacgttctttggttcctcgtttataagtaatgggccggctcctgatggacaaccg
ctagagattcctggcgcttttaggccagctgtggtcaccaaaactgggctagtgcttttt
gggaatgatggccaaaagctatcagtgaagaatatccagtttgaagatggtaagatgatt
ccagcatctcagtattataaaactgccgacagcgctgccctgcagctatccgacgaggag
aagaagttttcagaagaaatccgggcggcatggaagcggatcctcaccaatgtctctgaa
attgaagactccacagactttttcaaggccggagctgcttccatggatgtagtcaggctg
gtggaagaggtgaagctgaaatgcaatgggctgcagctgcagaatgaagacgtctatatg
gcaaccaagtttgaggaattcattcagatggtggtgaggcggctgagaggagaggatgga
gaagaagaactggttgtagattatgtggagaaggaaatcaacaacatgactgtcaaaata
cctcatcaacttttcataaatggacaatttattgatgcagaaggggggaagacctatgat
acagtcaaccctacagatgggacggcaatttgcaaagtatctttggcccaggtttctgat
atagacagggcagttgctgcagccaaggaagcctttgaaaatggagaatggggaaaaatg
aatccaagggacagaggtcgcatactatacagactggcagatataatggaggaacaccaa
gaagagctggctaccattgaatctatagactctggcgctgtctataccttggctttaaag
acccatgtgggcatgtctatccagacctttagatactttgcaggctggtgtgataaaata
cagggtagtaccattccaattaatcaggctcgtccaaaccggaatctgacatttaccagg
agagaacccattggtgtctgtgggattgtgataccatggaactaccccttgatgatgttg
gcatggaaaacagcagcttgccttgctgcgggcaacacagtggtactgaaacctgctcag
gtgaccccactgactgcactcaagtttgctgaattgtcggttaaagctggaattcccaaa
ggagtcataaatatcctgccaggagctggttctctgattggccagcgtctctccgaccac
cctgatgtcaggaaaattggcttcactggctccacacccataggaaaacatatcatgaaa
agctgtgctgtgggcaatgtaaagaaggtatccctggagctgggtggtaaatctcctctc
atcatcttccaagattgtgatctagacaaggctgtccgtatggggatgagctctgtgttt
ttcaataagggggagaactgcattgcagctggcagacttttcctagaagaatccatccat
gatgagtttgtgaagagagtggttggagaggtgaagaaaatgaagattggggacccactg
gacagatccacagatcatggaccacagaaccataaagcccacctggataaactgattgag
tactgtcagacaggcgtgaaggagggggccaagctggtatatggtgggaagcaggtggag
aggccaggttttttctttgagccgaccatatttacggatgttacagatgagatgtttatc
gcaaaagaggaatcatttggccccataatgatcatatccaagtttaaagatggggatgtt
gatgaggttcttaagcgagccaataatacagagttcggccttgcctcgggcgtattcaca
aaggatataagcaaagccctgtatgtcagcgagaagcttcaggctggaactgtgtttgta
aatacctacaacaaaaccgatgtagctgcgcccttcgggggcttcaaacaatctggattt
gggaaggacttgggcgaggaggcgctgaatgaatatctaaagacgaaagctgtcaccatt
gagtactga

DBGET integrated database retrieval system