KEGG   Xenopus tropicalis (western clawed frog): 496448Help
Entry
496448            CDS       T01011                                 

Gene name
cltc
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    496448 (cltc)
   04142 Lysosome
    496448 (cltc)
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   496448 (cltc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDANN
PIRRPISADNAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISDKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPETIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRINPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPTEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTLSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HATDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLVE
DKKECFAACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMREYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVPVPPQAAYGYGYTAPAYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcctcccgatccgcttccaggagcacctgcagctccaaaatctgggtatt
aatccagccaacattggttttagtacccttacaatggagtctgataaattcatctgcatt
cgggagaaggtaggagagcaagcccaggtggtaattattgacatgaatgatgccaacaac
ccgattcgcaggcctatttcagctgataatgccataatgaatccagccagcaaggtcatt
gctctgaaagccggaaaaacactccaaatttttaacattgaaatgaaaagcaagatgaag
gcccacaccatgacagatgatgtcaccttctggaaatggatctctttgaatactgtcgcc
ttagtgactgacaacgcagtctatcattggagtatggagggggaatctcagccagtaaag
gtgttcgaccgtcattcaagcttggcaggctgccagatcattaattatagaacagatgca
aagcaaaagtggctacttctgactggaatatctgcccagcaaaaccgtgttgtgggagcc
atgcagctttactccgtagacaggaaagtgtcccagcccatcgaaggacatgctgccagc
tttgctcagttcaagatggaaggaaatgctgaagaatcaaccctcttctgctttgctgta
aggggtcaagctgggggaaagctccatattatagaagttggtacaccacctacaggcaac
cagccttttccaaagaaagctgttgatgtcttctttcctccagaagctcagaatgacttt
cctgttgccatgcagattagtgacaagcatgatgttgtttttctgattacaaaatatggc
tacattcatctttacgacctagaaaccggaacctgcatttatatgaatcgtataagtggg
gaaaccatctttgttactgctcctcatgaagccacagctggaatcatcggagtaaacaga
aaggggcaggttctttctgtgtgtgttgaagaggagaacataatcccatatatcacaaac
gttctgcagaaccctgatctagccttgcgtatggctgtaagaaacaaccttgctggagct
gaggagctttttgctcgtaaattcaacgctctctttgcacagggaaattattcagaagca
gcaaaggtggctgcaaatgccccaaagggaatactacgtacaccagaaactatccgccgt
ttccaaagtgttcctgcacaaccaggtcaaacctccccattgctgcaatattttggaatt
cttttagaccaaggtcagctcaacaagtttgaatccttggagctttgcagacctgtgttg
caacaaggtcgcaaacagcttttggagaaatggctcaaggaagacaagctggagtgttct
gaagaattgggagatcttgtaaagtctgttgaccctacacttgccttgagtgtttatctg
agggctaatgttccaaacaaagtaattcagtgctttgcagagactgggcaggttcagaag
attgtgctctatgcaaagaaggtgggctatacacctgattggattttcctgctgcgaaat
gttatgagaatcaatccagatcaaggccaacagtttgctcaaatgttggtccaagatgag
gagcctcttgcagatatcacccagattgtggatgtctttatggaatacaaccttatccag
caatgcactgctttcttactggatgctctaaaaaataaccgtccaacagaaggccctttg
caaactcgtctccttgaaatgaatctgatgcatgcacctcaggtggctgatgcgattttg
ggcaaccagatgtttacacattatgatcgtgctcacattgcacagctttgtgagaaggca
ggcctccttcagagagctttggaacattttactgatctttatgacattaaaagggcagtt
gtccacactcatcttttgaatccagagtggctggtgaattattttggctccctgtctgtt
gaagattctcttgaatgcttgcgtgccatgctctctgcaaacatccggcaaaatttgcag
atatgtgtccaagtagcttccaaataccatgagcagctttccactctgtcgcttattgaa
ctttttgaatctttcaagagcttcgaagggctgttttattttctgggctctattgtcaac
ttcagccaggatcccgatgtgcattttaaatatatccaggcagcctgcaaaactggtcag
attaaagaagttgaaaggatatgtagagagagtaactgttatgatcccgagcgagtgaaa
aacttcctaaaggaagccaagctcacagaccagctgccactgataattgtatgtgatcgc
ttcgactttgtgcatgatcttgtgctgtatctgtacaggaacaacctacagaaatacatt
gagatctacgttcaaaaggtaaacccaagtcggttgccagtagttattgggggccttctt
gatgtggattgctcagaagatgtaattaagaaccttatccttgttgtgaggggacagttc
tctacagatgagcttgttgctgaagttgagaaaagaaacaggttaaaactccttttgcca
tggctggaatctcgaattcatgagggatgcgaagagcctgctactcataatgctttggct
aaaatatacatagatagcaataataatcctgaacgattcctacgagagaacccatactac
gacagtcgtgttgttggaaagtattgtgaaaaaagggatccccatcttgcatgcgttgca
tatgaacgaggacagtgtgacctggaactaataaatgtttgcaatgaaaattctcttttt
aaaagcctgtcccgttaccttgtacgtcgcaaagatccggaattgtgggccagtgtcttg
ttggaaagcaacccatataggagacctctaattgatcaggttgtgcagactgctttgtct
gaaacacaggatcctgaagaggtgtctgttactgtaaaagcctttatgacagcagacctt
cctaatgagctcattgaattgttggagaaaattgtgttggacaactctgtctttagtgaa
cacagaaatctgcagaacctcttgattctgactgcaattaaagctgaccgcacaagggtc
atggagtatattaaccgcctagataactatgatgccccggacattgcaaacattgccata
agcaatgagctgtttgaggaagcatttgctattttcaggaaatttgatgtgaacacttca
gctgtgcaggttctgattgaacacattgggaatttggaccgggcatatgagtttgctgag
cgatgcaatgaaccagctgtttggagtcagcttgccaaagcgcagttacagaaagggatg
gtcaaggaagctattgattcctacattaaagcagatgatccttcttcttacatggaagtt
gttcaagctgccaatgctagtggaaactgggaggagttggtcaaatacctgcaaatggct
cgcaaaaaggcacgagaatcctatgtggaaacagagctcatatttgctcttgctaaaaca
aatcgccttgcagaactagaagagttcattaatggaccaaataatgctcacattcagcag
gttggtgatcgctgctatgatgaaaaaatgtatgatgctgctaagctcctctataacaat
gtttccaattttggacgcttggcatccactttggttcacttaggagagtatcaagcagct
gtggatggtgctcgtaaggcaaatagcacacgcacttggaaagaggtttgctttgcttgt
gttgatggaaaagagtttcgcctagcacagatgtgtggtcttcatattgtggttcatgct
gatgaattggaggagcttataaattattaccaggatcgagggtattttgaagaacttatc
actatgttggaggcagctcttggactggaaagggcacacatgggaatgttcactgaactt
gcaatcctctactctaaatttaaaccccagaaaatgcgggagcacttggagctgttctgg
tcaagagtcaatattcctaaggtgctaagagcagcagagcaggctcacttgtgggcagaa
ttagtattcctgtatgataagtatgaagagtacgacaatgctatcatcacaatgatgaac
cacgccacagatgcatggaaggaaggacaatttaaagacatcattacaaaggttgcaaat
gttgaattgtattacagagcaatccagttttacttggagttcaagccactgttactgaat
gatcttctgatggtgctctcaccaagacttgaccacacccgtgcagtaaattatttctcc
aaggtgaaacaacttcctctggtaaaaccatatctgcgttcagttcagaatcacaacaac
aaatctgtgaatgaggctttaaacaatctgttcattacagaagaagattaccaggcactt
cggacatctatagatgcatatgacaactttgataatatttcccttgctcaacgactggag
aagcatgagctaattgaatttagaagaattgctgcatatctattcaagggcaataatcgt
tggaagcaaagtgtggagctttgtaaaaaagacaggctttacaaggatgctatgcagtat
gcctctgaatccaaagatacagaattggcggaggagcttctgcagtggtttttggttgag
gataaaaaggaatgctttgcagcctgtctctttacctgctatgacttgctgcgaccagat
gttgtcttggaaacagcatggaggcacaacatcatggactttgccatgccctacttcatt
caggtcatgagggagtacttaactaaggttgacaaactggatgcctccgaatctcttaga
aaagaagaagagcaagcaacagagacccagcccattgtttatggccagccacagctgatg
ttgactgcaggacccagtgttccagtacctcctcaagctgcgtatggctatggctatact
gcacctgcatatgggcaacctcaacctggctttgggtattccatgtaa

DBGET integrated database retrieval system