KEGG   Xenopus tropicalis (western clawed frog): 496571Help
Entry
496571            CDS       T01011                                 

Gene name
usp45
Definition
ubiquitin specific peptidase 45 (EC:3.1.2.15)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 291 aa AA seqDB search
MRVKEPSEWGAQEKTKRTKRTNLSLEEDSSDDIAGLTCHHVSQAVDVNHVKRAVSQAVWS
VCTECMKERRTQDGELVVPAEVWLCLKCGHQGCGANSECQHSLKHFEALHTEPHCIAINL
STWLTWCYKCDEELLTHCNKKVLAQMVDFLQKHSTRSAKGCSSKVIVLHEQRSKACETQK
GNSVSTCASVPVKGINNLGNTCFFNAVMQNLAQTHMLSDTLNEMKEKGTKLKINSSEDVH
LDPLVISLSSPGSLTSAVLLFLHNMKEAGKEPLSPKVLFSQLCQKSRYILT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagggttaaagagccatcagagtggggagctcaagagaagacaaaaagaactaagaga
acaaatctctctttagaagaagattcctctgatgatattgctggtctaacttgccatcat
gtgagtcaagcagtagatgtgaaccatgttaaaagagctgtctcacaggctgtgtggtca
gtatgcacagagtgtatgaaggagagaaggacacaagatggtgaattagttgtccctgca
gaagtctggctctgccttaaatgtggccatcagggctgtggagccaattctgaatgccag
cattctctaaaacactttgaggctctccacacagagcctcactgcattgcaatcaatctc
agcacatggctgacttggtgttacaaatgtgatgaagaactgttaacccactgcaacaaa
aaggtgctggcacagatggttgactttctccaaaagcattcaactcgttctgcaaaaggt
tgctcatctaaagttattgtattgcatgaacaaaggagcaaagcttgtgagacacaaaaa
ggaaactctgtttctacttgcgcttctgtaccagtcaagggaattaataatttgggcaac
acttgcttctttaatgcggtcatgcagaatttagctcaaacgcacatgttaagtgacact
ctgaatgaaatgaaggaaaaaggtacaaagctcaagatcaatagtagtgaagatgtgcac
ctggatccgttagtgatcagtctctccagtcctgggtctttgacatccgcagtgctctta
ttcctgcacaatatgaaggaggctgggaaagaacctctctctcctaaagtgctcttcagc
cagctgtgccagaagtcacgttacatattaacatag

DBGET integrated database retrieval system