KEGG   Xenopus tropicalis (western clawed frog): 496734Help
Entry
496734            CDS       T01011                                 

Gene name
pdia2, XPDIp, pdi, pdip
Definition
protein disulfide isomerase family A, member 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     496734 (pdia2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 526 aa AA seqDB search
MRWLTALQLCLLCTFYTVALGQNATSEEPTKNSSEEETSDELLEEDNVLVLNKKNFDKAL
ETYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNG
YPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRLGPAAIVLDKVESAEKFTSSQESPVI
GFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTEDTVIFFKNSEEKPEFKVD
EDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHF
RKAATHFKGKILFVFIDSDGGFSSVLEYFGLKSSDVPTLRFINLESVKKYAFDAPEITED
TIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNFEEVAYDESKSVFVEFYAPWC
SHCKELEPVWEELGEKYKDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEY
TKERTVELFSAFIDSGGVLPEEQVEKDAEAEESKEVAEEDKGKDEL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggctcactgcgctccagctctgccttctgtgcacgttttataccgtggcgctt
ggccaaaatgcgacttctgaggaacccacgaagaactcaagcgaggaggagacatcagac
gagcttctggaagaggacaacgtcttggttctaaacaagaagaactttgacaaggccctt
gagacctataaatatctcctagtggagttctatgctccttggtgcggtcattgccaagag
cttgctccaaaatacgccaaggcggcggagatcctgaaggacaagtcagaagaagtgagg
ctggctaaagtagatgccaccgtagaatctgaactgagcatggagtttaatgtgaatggg
tatcccaccctgaaattctttaaaggtggaaacagaacgggccacatcgattatggagga
aagagggaccaagatggcttggtgaagtggatgctgagacgtttggggccggcagccatt
gtgcttgataaagtagaaagtgctgagaaattcaccagctcccaagaatctccagtgatt
ggtttcttcaagaacccggaagatgccgatatcaaaatattttatgaagctgcggagctt
aatgaagacttcacttttgccctggcccacgatgcaaaactgtttgagaaattcggagtg
acggaagacacggtcatcttcttcaaaaactctgaggagaagcctgagtttaaagttgat
gaagaccttggattagacaaagatgagctttccaagttcctcaagataaacaacatcgac
ctcgtcacagaatacagcgctgagacttccgataagatttttgctgcccagatccccaac
cacttgctgctttttatcaataagactgaggattcccaactggcgctgttggaacatttc
cgcaaagcggcgacccactttaaagggaaaatcctcttcgtttttatcgactccgacggc
ggtttttcttcggtccttgagtatttcgggctgaaatcatcggacgttccaaccctccga
tttataaacctggagtcggtgaagaagtacgcgttcgatgccccggaaatcacggaagac
actatccaaacattctgcaggactgtccttgagggaaacgtcaagcaaaacctcatgagt
gaggaaatcccggccgattgggataagaatccagtgaaggttctggtggggaagaacttt
gaagaggtggcgtatgatgaaagcaagagtgtgtttgtagaattctatgccccttggtgc
tctcactgcaaagagctggaaccagtctgggaagaactaggggaaaagtacaaggaccac
gagagcgttatcatcgccaaaatggacgccaccgccaacgagatcgatgggctccgagta
cgaggattccccaacctgaggtttttccctgcgggccccgggcgcaagatgattgaatat
acaaaggaaaggaccgttgagctgttttcggccttcattgacagtgggggggtgctgccc
gaggagcaagtggaaaaggatgctgaagcagaggagagcaaggaagtggcggaggaagac
aaaggaaaggatgagttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system