KEGG   Xenopus tropicalis (western clawed frog): 496734Help
Entry
496734            CDS       T01011                                 

Gene name
pdia2, XPDIp, pdi, pdip
Definition
(RefSeq) protein disulfide isomerase family A member 2
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     496734 (pdia2)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   496734 (pdia2)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    496734 (pdia2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_2 Thioredoxin_8 OST3_OST6 AhpC-TSA ERp29_N Thioredoxin_4 HyaE DUF3198 TPR_3
Motif
Other DBs
NCBI-GeneID: 496734
NCBI-ProteinID: NP_001011281
Xenbase: XB-GENE-5770794
UniProt: Q5M8J6
Position
9
AA seq 526 aa AA seqDB search
MRWLTALQLCLLCTFYTVALGQNATSEEPTKNSSEEETSDELLEEDNVLVLNKKNFDKAL
ETYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNG
YPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRLGPAAIVLDKVESAEKFTSSQESPVI
GFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTEDTVIFFKNSEEKPEFKVD
EDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHF
RKAATHFKGKILFVFIDSDGGFSSVLEYFGLKSSDVPTLRFINLESVKKYAFDAPEITED
TIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNFEEVAYDESKSVFVEFYAPWC
SHCKELEPVWEELGEKYKDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEY
TKERTVELFSAFIDSGGVLPEEQVEKDAEAEESKEVAEEDKGKDEL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggctcactgcgctccagctctgccttctgtgcacgttttataccgtggcgctt
ggccaaaatgcgacttctgaggaacccacgaagaactcaagcgaggaggagacatcagac
gagcttctggaagaggacaacgtcttggttctaaacaagaagaactttgacaaggccctt
gagacctataaatatctcctagtggagttctatgctccttggtgcggtcattgccaagag
cttgctccaaaatacgccaaggcggcggagatcctgaaggacaagtcagaagaagtgagg
ctggctaaagtagatgccaccgtagaatctgaactgagcatggagtttaatgtgaatggg
tatcccaccctgaaattctttaaaggtggaaacagaacgggccacatcgattatggagga
aagagggaccaagatggcttggtgaagtggatgctgagacgtttggggccggcagccatt
gtgcttgataaagtagaaagtgctgagaaattcaccagctcccaagaatctccagtgatt
ggtttcttcaagaacccggaagatgccgatatcaaaatattttatgaagctgcggagctt
aatgaagacttcacttttgccctggcccacgatgcaaaactgtttgagaaattcggagtg
acggaagacacggtcatcttcttcaaaaactctgaggagaagcctgagtttaaagttgat
gaagaccttggattagacaaagatgagctttccaagttcctcaagataaacaacatcgac
ctcgtcacagaatacagcgctgagacttccgataagatttttgctgcccagatccccaac
cacttgctgctttttatcaataagactgaggattcccaactggcgctgttggaacatttc
cgcaaagcggcgacccactttaaagggaaaatcctcttcgtttttatcgactccgacggc
ggtttttcttcggtccttgagtatttcgggctgaaatcatcggacgttccaaccctccga
tttataaacctggagtcggtgaagaagtacgcgttcgatgccccggaaatcacggaagac
actatccaaacattctgcaggactgtccttgagggaaacgtcaagcaaaacctcatgagt
gaggaaatcccggccgattgggataagaatccagtgaaggttctggtggggaagaacttt
gaagaggtggcgtatgatgaaagcaagagtgtgtttgtagaattctatgccccttggtgc
tctcactgcaaagagctggaaccagtctgggaagaactaggggaaaagtacaaggaccac
gagagcgttatcatcgccaaaatggacgccaccgccaacgagatcgatgggctccgagta
cgaggattccccaacctgaggtttttccctgcgggccccgggcgcaagatgattgaatat
acaaaggaaaggaccgttgagctgttttcggccttcattgacagtgggggggtgctgccc
gaggagcaagtggaaaaggatgctgaagcagaggagagcaaggaagtggcggaggaagac
aaaggaaaggatgagttgtaa

DBGET integrated database retrieval system