KEGG   Xenopus tropicalis (western clawed frog): 496738Help
Entry
496738            CDS       T01011                                 

Gene name
rac2, en-7, hspc022
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    496738 (rac2)
   04310 Wnt signaling pathway
    496738 (rac2)
   04370 VEGF signaling pathway
    496738 (rac2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    496738 (rac2)
   04520 Adherens junction
    496738 (rac2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    496738 (rac2)
GTP-binding proteins [BR:xtr04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    496738 (rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
4
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKETIEKLKEKKLSPISYPQGLALAKEIEAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PSRPNKAKCVVL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccattaaatgtgtagtggtgggcgatggagctgtgggtaaaacatgtcttctc
atcagttatacaaccaatgctttccccggggaatacatcccgactgtatttgacaattat
tcagcgaatgtgatggttgacagtaagcctgtaaacttgggtttatgggatacagctggc
caggaggactatgatcgactgagacctctctcctatccccagacagatgtgtttctgatt
tgcttttccctggtgagtccggcatcttatgagaacgtccgtgccaagtggtacccagaa
gtgagacaccattgtcccagcacacccatcattcttgttggaaccaagctggatctgcgg
gatgacaaagaaaccattgagaaacttaaagagaagaaactgtccccaatctcttaccca
cagggtttggctctggcaaaagagattgaggcagtcaaatacttggagtgctcagcctta
acgcaacgtggcctaaagacggtatttgatgaggctatccgagcggtgctgtgtccccct
ccttcgaggcctaacaaagccaaatgtgtggtgctttaa

DBGET integrated database retrieval system