KEGG   Xenopus tropicalis (western clawed frog): 496769Help
Entry
496769            CDS       T01011                                 

Gene name
spaca5, lyc5, lyzl5, sllp2
Definition
sperm acrosome associated 5 (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 140 aa AA seqDB search
MKIFVLLMITAAFAAHSWALDRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTSLN
RSPTEYGIFQINSYWWCNDGRTVGRKNLCGMSCTNLLNSYIDDDVRCLKRIVRDPNGLGA
WSVWTRYCKGRDLSSYTDFC
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctttgttttgcttatgatcactgcagcgtttgctgctcacagctgggcatta
gataggtgcagtgtggttagagcgattagaaatgggggagttattggcatcaaaggatat
acactgggggactatgtgtgcttagcttaccaagccagccgctacgacacttccctcaac
agaagcccaacagagtatggtatcttccagatcaacagctactggtggtgcaacgatggc
agaaccgtagggcgcaagaacctctgtggaatgtcctgtacaaatttactgaacagttac
attgacgatgatgtgaggtgccttaaaaggattgtgagagatcccaatggacttggtgct
tggagtgtttggaccagatactgcaaaggaagagacctaagctcatacaccgacttttgc
taa

DBGET integrated database retrieval system