KEGG   Xenopus tropicalis (western clawed frog): 496773Help
Entry
496773            CDS       T01011                                 

Gene name
art5
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     496773 (art5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 322 aa AA seqDB search
MGSPGAGIVANALLSQMDHLMRIWPIVWLLLQPIITQETLSEAPMDLEEDTFDDQYIGCR
DQVDLLMDEILKTEKSKNRLLRRAWTEAENIWNIRRHEIQSELPVGFRDSHGVALVAYSG
FIRTYFDEAVVSAGKSYNDYIQRFQYKGLHFYLTVAVQLLSGGCQKRPKLVYLGTNGFWY
PTNSLEEVKFGHFVSTYSEKEQAVAFGNDTVFTISSCYGVQVEKFSQFPQEKAVLVPNYE
IFSVHEGEVNEFALISTKRTCSKFNCALIRGEGSQLKPGECAPDSRATQRISDSAMRDLP
FNLLYIAVSFLLGARHLLLISL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggggagccctggggccgggattgtggccaacgctttactgagccaaatggatcatctg
atgaggatctggccaatcgtatggctcctgctccagcccataataacgcaggaaaccctc
tcagaagcccccatggatctggaagaagatacgtttgatgaccagtatattgggtgtagg
gaccaagtggaccttctcatggatgagatcctgaagactgagaagtcaaagaatagatta
ttgagacgcgcttggacagaagcagagaacatatggaacatcaggagacacgagatccag
tcagagcttccggtgggctttagagacagccacggggttgccttggtggcctattctggg
ttcattagaacatactttgatgaagccgtggtctctgccggcaagtcctacaatgactac
atccagcggttccagtacaaaggcctccatttctacctgacggtggccgtgcagctcctg
tctggggggtgccagaagagacccaaactggtttatcttgggaccaatgggttttggtac
ccaactaactctttagaagaagtcaagttcggccattttgtatctacctactcagagaag
gaacaagcggtggcctttggtaacgacaccgtctttactatcagtagctgctacggggtc
caggtggaaaagttctcccagttcccccaggagaaggcagttctggttccgaactatgag
atcttctcggtccatgagggagaggtcaatgagtttgcccttatcagcaccaaacggacc
tgcagcaaattcaattgcgccctaattagaggggagggatcacagctgaaacccggggag
tgcgcccccgactcccgtgccacacagaggatttccgactcagcgatgcgtgacttgccc
tttaatctgctttacattgctgtgtcattcctgttgggcgcccggcatttattactcatt
agtctctaa

DBGET integrated database retrieval system