KEGG   Xenopus tropicalis (western clawed frog): 496800Help
Entry
496800            CDS       T01011                                 

Gene name
rbks
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    496800 (rbks)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     496800 (rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 310 aa AA seqDB search
MVTPQVIVVGSCMTDLVSVTPRLPKAGETIHGSKFFIGFGGKGANQCIQAARLGVKTSMV
CKVGKDSFGNDYIANFTKNHVSTDFVGQTAEAATGAASIIVNAEGQNAIVIVAGANLLLD
SEDLKRASTAISRANVLVCQLEIRPEISLEALKMARSSGVKTIFNPAPAVAQLDPEFFTH
SDIFCCNESEAEILTAAPVNSPQEAGTAGALLLEKGCKVVIITLGGEGCVILSQEDPTPK
HISTNKVKAVDSTGAGDSFVGALAYYMALYPHLCMEDMVKRSNYIASVSVQTAGTQTSYP
HRAELPQGMF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgccacaagtgattgtcgtgggttcctgtatgaccgaccttgtcagtgtgacg
ccccggttgcccaaagccggtgagaccatccatggcagcaagttttttattggctttggg
ggcaaaggggcaaaccagtgtatccaggcagcccgactgggtgtgaagacctcaatggtt
tgcaaggttggaaaggattcgtttgggaacgattatatcgcaaatttcaccaagaaccat
gtttctacagattttgtgggccagacggcagaggccgccactggagcagcttctatcatt
gtgaatgcggaaggacaaaatgctatagtgatagtggctggggccaatttgctgctggac
tctgaggacctaaagcgagcctccacggctatcagcagggccaacgtattggtgtgccag
ttggagataaggcctgagatctcgttagaggccctgaaaatggcccgttccagtggagtt
aagacgatattcaacccagctccggccgtggcacaactagaccccgagtttttcacccat
tcggatatcttctgctgcaacgagagcgaggcggaaattctgactgctgctcccgtaaac
agtccgcaggaagccggtaccgcgggggcacttctgctggagaaggggtgcaaggtggtc
attattaccctcgggggagagggctgcgttatcctgtcacaagaggatcccaccccaaag
cacatatctacaaacaaagtgaaagcagtggacagtacgggagcgggggacagttttgtg
ggggctctggcctattacatggcgctttacccccacctctgcatggaagatatggtgaaa
cggtccaactacatcgcgtcggtgagcgtccaaacggcggggacccagacctcctaccca
cacagggctgagctcccccagggcatgttctaa

DBGET integrated database retrieval system