KEGG   Xenopus tropicalis (western clawed frog): 496810Help
Entry
496810            CDS       T01011                                 

Gene name
pbk, topk
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     496810 (pbk)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   496810 (pbk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 325 aa AA seqDB search
MQEPNSFRTPCKVQKLKSPPGVFTPPPFVIPASPFMQKFGYGTGVSVYLMKRSPRGASRS
PWAIKKISKQCDASSRNLYEQRLNEEAKVLRNLQHPNIVGYRAFTKSKDGSLCLAMEYGG
EKSLNDLIEERNDNELGPFPATDILKVAENMARGLKYLHNEKRILHGDIKSSNVVVKGDF
ESVKICDVGVSLPLDENMIVSDPKAYYIGTESWKPKEALDEGGVITDKSDIYAFGLTLWE
MMSLSIPHLNLPPEDDEEDTFDEDDFDEDAYYEALGTRPPLNMEELDDSYQKVIELFYMC
AHEDPKLRPSAAKIIEVLEAEDKKS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagccgaatagtttcaggaccccctgcaaggtgcagaagctgaagtcccctcca
ggagtttttactccgcccccttttgtgattccggcctcaccgtttatgcagaaatttggg
tacggcaccggcgtcagcgtctatctaatgaaacgatcccctcggggtgcctctcgctcc
ccctgggctataaagaagataagcaagcagtgtgacgcttccagccgtaacctctatgaa
caaagactcaatgaagaagccaaagtgctaaggaacctgcagcaccccaatattgtaggt
taccgggccttcaccaaatccaaggatggcagcctgtgtctggctatggagtatggggga
gagaagtctctgaatgatctgatagaggagcggaacgataacgagttggggcccttccct
gcgactgacattctaaaggtggcagagaacatggcaagaggcttgaagtatctgcacaac
gaaaaaaggattctgcacggggacatcaagtcatctaatgtcgtcgtaaagggcgacttc
gaatccgtcaagatctgcgatgttggggtgtcgctgcctctggatgagaacatgattgtg
agcgacccaaaggcctattatattggcacagagtcgtggaagccaaaggaggccttggac
gaaggcggagtcataacggacaaatctgacatctatgcattcggcctgaccctgtgggag
atgatgagcctgtccataccccatttaaacctgcctcctgaagatgacgaagaagacaca
ttcgacgaagatgactttgacgaagatgcttactacgaggctttggggacccggcctccc
ctcaacatggaggaacttgacgattcctaccagaaggttattgagctcttctacatgtgc
gcccacgaagacccaaagctgcgcccctctgctgccaaaatcatcgaggttctagaggcg
gaagataagaagagctaa

DBGET integrated database retrieval system