KEGG   Xenopus tropicalis (western clawed frog): 496875Help
Entry
496875            CDS       T01011                                 

Gene name
thbs3, tsp-3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:xtr04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:xtr04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 959 aa AA seqDB search
MARQSRDLLLLLLLSCLVCWARAARQEVHVIDLLTVSESRHMSGVVEKIRSELLAVNDLY
FLSTFRLPPKAGGVLFGLYSKKDNTKWLEASIVGKINKVLVRYMREDSKLHAVSLQNANL
SDGNMHTMILRVSGFRGDTLSLELYVDCKQVDTSLGLPEMMIIPQFEVESGDIRSGHKAY
LRMQGSVESMKLILGGSLSRVGALSECPFQEDESIHNTVNGVVNSILGEHTKALIAQMTL
FNKVLAELREDIRDQVKEMSLIRNTIMECQVCGFHEHRSRCNPNPCFQGVDCMETYEYPG
FRCGPCPPGSQGNGTHCADIDECSHANPCFSGSKCINTSPGFRCEHCPRGYKGNTVSGVG
VDYAKASKQVCKDIDECNDGNNGGCDANSICTNTVGSFRCGPCKPGFVGNQTVGCAPKKS
CASPAFNPCHLNGHCVFERSGDITCACNVGWAGNGYTCGRDTDLDGYPDEPMPCIDNNKH
CRQDNCRLTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLVPNKDQQNSDTDSFGD
ACDNCPNVPNNDQRDTDANGEGDACDNDIDGDGIPNMLDNCPKVPNPLQTDRDLDGVGDA
CDSCPEASNPTQADADSDLVGDMCDTNQDRDGDGHQDTKDNCPDIPNSSQLDSDNDGKGD
ECDQDDDNDGIPDYMPPGPDNCRLMHNPNQKDSDGDGVGDVCEEDFDNDTVIDPLDVCPE
SAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDF
EGTFHVNTVTDDDYAGFIFSYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGLQLKAVKS
TTGPGEQLRNALWNTGHTQDQVRLLWKDPRNVGWKDKTSYRWQLMHRPQVGYIRVKLYEG
VDLVADSGVIIDTNMRGGRLGVFCFSQENIIWSNLQYRCNDTIPEDFEPYRRGLQEGKD
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcgagacagagccgagacctcctcctactgctgcttctctcctgccttgtgtgctgg
gcacgggcagccaggcaagaggtgcacgtgatcgacctcctgacggtcagcgagtcccgg
cacatgtccggcgtggtggaaaagatccgctcggagctgctggcggtcaatgacctttac
ttcctgtccaccttccggctgccccccaaggcaggaggggtcctgtttggcctctactcc
aaaaaggataacaccaaatggttggaggcctccatagtgggcaagatcaacaaagtgcta
gtgcgttacatgagggaagactccaagcttcatgccgtcagtctacagaatgccaacctg
tcagatgggaatatgcacacaatgatcctccgcgtgagcggcttccggggggacactctc
tctctggaattgtacgtagactgcaagcaggtggacaccagcctggggcttccagaaatg
atgatcattccccagtttgaggtggagtctggggatatccgctctggacacaaagcctac
ctaaggatgcagggatctgtagagtccatgaaactgatcctcggtgggtccctgagtcgc
gtgggggctctaagtgagtgccctttccaggaagatgagtccattcacaacacagtcaac
ggagtggtcaattctatccttggtgagcacaccaaagctttgatcgcccaaatgactctc
ttcaataaagtgttagcggagctgagagaggacatacgagaccaggtcaaagagatgtcg
ctgatcaggaacaccatcatggaatgccaagtgtgcgggtttcatgagcaccgctcccgc
tgtaaccccaacccctgctttcaaggagtcgactgtatggaaacgtatgagtatccgggg
ttccgctgtggcccctgcccgccgggatcccaaggcaatggcacccactgtgccgatata
gatgagtgctcccacgccaacccttgtttctctggctccaaatgcatcaacacgtcaccg
ggcttccgctgcgagcattgcccacgggggtacaagggcaacaccgtgtctggggtggga
gtggactacgccaaagccagtaaacaggtttgcaaagacattgacgaatgtaacgatgga
aacaacggagggtgcgacgccaactccatctgcaccaacactgtgggatcattcagatgt
ggcccctgcaagcccggctttgtgggtaaccagacggtagggtgtgcccccaagaaatcc
tgcgccagcccagccttcaacccgtgccacctgaatgggcattgtgtgtttgagaggagc
ggagacatcacgtgcgcatgtaatgtcggctgggcagggaatggctacacgtgtggccga
gacactgacctggatggctacccagatgagccaatgccttgtatagacaacaataagcat
tgcaggcaggataactgccgcctgacgcccaactctgggcaggaagatgccgacaacgat
ggaattggggaccagtgcgatgaagatgccgatggggacgggatcaagaatgttgaggac
aactgccgcctggtgcccaacaaggaccagcagaactcggacaccgactcgtttggagac
gcctgtgacaattgccccaatgtgcccaataacgaccagagggacacggacgccaacggg
gagggagacgcctgtgacaatgacattgatggcgacgggatccccaacatgctcgacaac
tgccccaaagtgcccaaccccctgcagactgaccgagaccttgatggggtgggggatgcc
tgtgacagctgccccgaggccagtaaccccacccaggcagatgctgacagcgacttggtt
ggggacatgtgtgataccaatcaggacagggatggagatggccaccaggacaccaaagac
aactgccccgatatccccaacagctcccagttagactcggacaacgatgggaaaggagac
gagtgcgaccaagacgatgataatgatggaatccctgattacatgccaccagggccagac
aattgccggctgatgcataaccccaaccagaaggactcggatggggacggggttggagat
gtgtgtgaggaagactttgataacgacaccgtcatcgaccccctggacgtctgtcctgaa
agtgcagaagtcactctcaccgacttcagagcctatcagaccgttatcttggaccctgag
ggcgacgcccagatagaccctaattgggttgtgttgaatcagggaatggagattgtgcag
acaatgaacagtgaccctggcttggcagttggttatacggctttcaacggggtggacttt
gagggcacattccacgtaaatacggtgaccgacgatgactatgccggctttatcttcagc
taccaggacagttccagcttctacgtggtcatgtggaaacagacagagcagacctactgg
caggcaacccccttccgagctgtggcagagccgggactgcagctaaaggctgtgaaatcc
acaacgggccccggtgagcagcttcgcaatgccctgtggaacaccggtcacacccaagac
caggtccgtttgctgtggaaggaccctcgtaacgttggctggaaggacaagacttcttat
cgttggcagctcatgcatcgcccccaagtgggctacatcagggtaaagctttatgaagga
gttgacctggtggctgattccggagtaattatagacacaaatatgcgagggggacgattg
ggggtcttctgcttctcccaggagaacatcatttggtccaacttacagtaccggtgtaat
gacacaattccagaagactttgaaccgtaccgacggggtctacaggaagggaaggattaa

DBGET integrated database retrieval system