KEGG   Xenopus tropicalis (western clawed frog): 496875Help
Entry
496875            CDS       T01011                                 

Gene name
thbs3, tsp-3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    496875 (thbs3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    496875 (thbs3)
  Cellular commiunity
   04510 Focal adhesion
    496875 (thbs3)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   496875 (thbs3)
  Exosomal proteins of colorectal cancer cells
   496875 (thbs3)
  Exosomal proteins of bladder cancer cells
   496875 (thbs3)
Heparan sulfate/heparin binding proteins [BR:xtr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  496875 (thbs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 959 aa AA seqDB search
MARQSRDLLLLLLLSCLVCWARAARQEVHVIDLLTVSESRHMSGVVEKIRSELLAVNDLY
FLSTFRLPPKAGGVLFGLYSKKDNTKWLEASIVGKINKVLVRYMREDSKLHAVSLQNANL
SDGNMHTMILRVSGFRGDTLSLELYVDCKQVDTSLGLPEMMIIPQFEVESGDIRSGHKAY
LRMQGSVESMKLILGGSLSRVGALSECPFQEDESIHNTVNGVVNSILGEHTKALIAQMTL
FNKVLAELREDIRDQVKEMSLIRNTIMECQVCGFHEHRSRCNPNPCFQGVDCMETYEYPG
FRCGPCPPGSQGNGTHCADIDECSHANPCFSGSKCINTSPGFRCEHCPRGYKGNTVSGVG
VDYAKASKQVCKDIDECNDGNNGGCDANSICTNTVGSFRCGPCKPGFVGNQTVGCAPKKS
CASPAFNPCHLNGHCVFERSGDITCACNVGWAGNGYTCGRDTDLDGYPDEPMPCIDNNKH
CRQDNCRLTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLVPNKDQQNSDTDSFGD
ACDNCPNVPNNDQRDTDANGEGDACDNDIDGDGIPNMLDNCPKVPNPLQTDRDLDGVGDA
CDSCPEASNPTQADADSDLVGDMCDTNQDRDGDGHQDTKDNCPDIPNSSQLDSDNDGKGD
ECDQDDDNDGIPDYMPPGPDNCRLMHNPNQKDSDGDGVGDVCEEDFDNDTVIDPLDVCPE
SAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDF
EGTFHVNTVTDDDYAGFIFSYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGLQLKAVKS
TTGPGEQLRNALWNTGHTQDQVRLLWKDPRNVGWKDKTSYRWQLMHRPQVGYIRVKLYEG
VDLVADSGVIIDTNMRGGRLGVFCFSQENIIWSNLQYRCNDTIPEDFEPYRRGLQEGKD
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcgagacagagccgagacctcctcctactgctgcttctctcctgccttgtgtgctgg
gcacgggcagccaggcaagaggtgcacgtgatcgacctcctgacggtcagcgagtcccgg
cacatgtccggcgtggtggaaaagatccgctcggagctgctggcggtcaatgacctttac
ttcctgtccaccttccggctgccccccaaggcaggaggggtcctgtttggcctctactcc
aaaaaggataacaccaaatggttggaggcctccatagtgggcaagatcaacaaagtgcta
gtgcgttacatgagggaagactccaagcttcatgccgtcagtctacagaatgccaacctg
tcagatgggaatatgcacacaatgatcctccgcgtgagcggcttccggggggacactctc
tctctggaattgtacgtagactgcaagcaggtggacaccagcctggggcttccagaaatg
atgatcattccccagtttgaggtggagtctggggatatccgctctggacacaaagcctac
ctaaggatgcagggatctgtagagtccatgaaactgatcctcggtgggtccctgagtcgc
gtgggggctctaagtgagtgccctttccaggaagatgagtccattcacaacacagtcaac
ggagtggtcaattctatccttggtgagcacaccaaagctttgatcgcccaaatgactctc
ttcaataaagtgttagcggagctgagagaggacatacgagaccaggtcaaagagatgtcg
ctgatcaggaacaccatcatggaatgccaagtgtgcgggtttcatgagcaccgctcccgc
tgtaaccccaacccctgctttcaaggagtcgactgtatggaaacgtatgagtatccgggg
ttccgctgtggcccctgcccgccgggatcccaaggcaatggcacccactgtgccgatata
gatgagtgctcccacgccaacccttgtttctctggctccaaatgcatcaacacgtcaccg
ggcttccgctgcgagcattgcccacgggggtacaagggcaacaccgtgtctggggtggga
gtggactacgccaaagccagtaaacaggtttgcaaagacattgacgaatgtaacgatgga
aacaacggagggtgcgacgccaactccatctgcaccaacactgtgggatcattcagatgt
ggcccctgcaagcccggctttgtgggtaaccagacggtagggtgtgcccccaagaaatcc
tgcgccagcccagccttcaacccgtgccacctgaatgggcattgtgtgtttgagaggagc
ggagacatcacgtgcgcatgtaatgtcggctgggcagggaatggctacacgtgtggccga
gacactgacctggatggctacccagatgagccaatgccttgtatagacaacaataagcat
tgcaggcaggataactgccgcctgacgcccaactctgggcaggaagatgccgacaacgat
ggaattggggaccagtgcgatgaagatgccgatggggacgggatcaagaatgttgaggac
aactgccgcctggtgcccaacaaggaccagcagaactcggacaccgactcgtttggagac
gcctgtgacaattgccccaatgtgcccaataacgaccagagggacacggacgccaacggg
gagggagacgcctgtgacaatgacattgatggcgacgggatccccaacatgctcgacaac
tgccccaaagtgcccaaccccctgcagactgaccgagaccttgatggggtgggggatgcc
tgtgacagctgccccgaggccagtaaccccacccaggcagatgctgacagcgacttggtt
ggggacatgtgtgataccaatcaggacagggatggagatggccaccaggacaccaaagac
aactgccccgatatccccaacagctcccagttagactcggacaacgatgggaaaggagac
gagtgcgaccaagacgatgataatgatggaatccctgattacatgccaccagggccagac
aattgccggctgatgcataaccccaaccagaaggactcggatggggacggggttggagat
gtgtgtgaggaagactttgataacgacaccgtcatcgaccccctggacgtctgtcctgaa
agtgcagaagtcactctcaccgacttcagagcctatcagaccgttatcttggaccctgag
ggcgacgcccagatagaccctaattgggttgtgttgaatcagggaatggagattgtgcag
acaatgaacagtgaccctggcttggcagttggttatacggctttcaacggggtggacttt
gagggcacattccacgtaaatacggtgaccgacgatgactatgccggctttatcttcagc
taccaggacagttccagcttctacgtggtcatgtggaaacagacagagcagacctactgg
caggcaacccccttccgagctgtggcagagccgggactgcagctaaaggctgtgaaatcc
acaacgggccccggtgagcagcttcgcaatgccctgtggaacaccggtcacacccaagac
caggtccgtttgctgtggaaggaccctcgtaacgttggctggaaggacaagacttcttat
cgttggcagctcatgcatcgcccccaagtgggctacatcagggtaaagctttatgaagga
gttgacctggtggctgattccggagtaattatagacacaaatatgcgagggggacgattg
ggggtcttctgcttctcccaggagaacatcatttggtccaacttacagtaccggtgtaat
gacacaattccagaagactttgaaccgtaccgacggggtctacaggaagggaaggattaa

DBGET integrated database retrieval system