KEGG   Xenopus tropicalis (western clawed frog): 496896Help
Entry
496896            CDS       T01011                                 

Gene name
uox
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    496896 (uox)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    496896 (uox)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     496896 (uox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 304 aa AA seqDB search
MAQYHGRLSKDSDVEFAHTAYGKNAVKVLQIKRNGKQHFIKEIEVSVQLTLKSKKDYLEG
DNSDIIPTDTIKNTIYALTKLKGIQTIEEFSVEIARHFLTSFNHVTEVKVFINEAPWRRM
EKNGMSHVHAFIYSPEGVHFCELQQKRGGQPAIFSGIKELRILKTTQSGFEGFIKDRFTT
LPEVKDRCFSTIVNCKWKYGTSKAVDYDAVWKTILETILDTFAGPYDKGEYSPSVQKTLY
DIQVLSLRKVPEIEEIEIILPNKHYFTIDMSKMGLTNQDEVLMPTDIPYGNIAGTLRRNP
SSKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtaccatggacgtctatcaaaggattcagatgttgagtttgctcacacagcc
tatggcaaaaatgcagttaaagtccttcagatcaagaggaatggaaagcaacattttatt
aaagaaatagaagtctctgttcagcttaccttaaagtccaagaaggattatttggaggga
gataattccgacattattcctacagatacaattaaaaacaccatctatgccttgacaaaa
ctcaaagggattcaaacaatagaagaattttccgtggagatagcaagacattttctcacc
tcctttaaccatgttactgaagttaaagtttttattaatgaagccccatggaggcgtatg
gaaaagaatggaatgagccacgtgcatgcatttatttattcacctgaaggggttcacttc
tgtgagctgcaacaaaaacggggaggtcaaccggctattttctctggtatcaaagaacta
agaattctgaaaacaacacaatctggattcgaaggtttcataaaagaccgttttactact
cttcctgaagtgaaagatcgctgcttttcaacaattgtcaactgcaaatggaaatatggc
accagtaaagcagttgattatgatgccgtttggaaaaccattttggaaaccattcttgat
acatttgctggtccctatgacaaaggagaatattctccatctgtgcagaagactctctat
gacatccaggtgctgagcctaaggaaagttccagagattgaagaaattgaaatcatcctt
ccaaacaaacattattttaccattgacatgagcaaaatgggattgaccaaccaggatgag
gtgttgatgcctacggacattccatatggaaatattgctggaactttaagacggaatccg
tcttcgaaactgtaa

DBGET integrated database retrieval system