KEGG   Xenopus tropicalis (western clawed frog): 496906Help
Entry
496906            CDS       T01011                                 

Gene name
adh6, ADH1A
Definition
alcohol dehydrogenase 6 (class V) (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    496906 (adh6)
  Lipid metabolism
   00071 Fatty acid degradation
    496906 (adh6)
  Amino acid metabolism
   00350 Tyrosine metabolism
    496906 (adh6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    496906 (adh6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    496906 (adh6)
   00982 Drug metabolism - cytochrome P450
    496906 (adh6)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     496906 (adh6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 376 aa AA seqDB search
MAAAGKVIKCKAAVAWAAKQPFSIEDIEVAPPKAHEVRVKMVATGICRSDDHVLNGSMSF
PNFPVILGHEGAGIVESIGPGVKNIKPGDKVITLFNPQCRECKNCLDPKSNVCIKSDIGK
LTGLMLDNTSRFTCKGKQIHHFVHTSTFTEYTVLDEMAVAKIHNDAPLDKVCLIACGFST
GYGSALNTAKVEPGSTCAVFGLGGVGLSVIIGCKVAGAAKIIGVDTNGDKFAKAKEVGAT
ECINPNDYKEPIHKVLEKMTDGGLDYSFECIGNTRVMASALLSTKFACGTSVIVGVAPST
AELNLDPMVILTGRTLKGSLFGGWKSKDCVPKLVADFMENKFELDGLISHKLPLQKINEG
FDLLHKGTSLRTVLYF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgctgggaaagtgattaaatgcaaagctgcggtggcctgggcagctaagcaa
cccttcagcattgaggacattgaagttgctcctccaaaggctcatgaagttcgcgtaaag
atggtggcaactgggatttgccgatcagatgaccatgtacttaatggatcaatgagtttt
ccgaactttcctgtgattctgggccatgaaggtgctggtatagtggaaagcattggccca
ggagtgaaaaatataaaaccaggagacaaagtcatcactctcttcaatccccagtgcaga
gaatgcaaaaactgtttagatcccaagagcaacgtgtgcattaaatctgacattggtaaa
ttaactggattgatgttggacaacaccagcagatttacatgcaaggggaaacagatccac
cactttgtgcataccagcacctttactgaatacactgtgttggatgaaatggcagttgct
aagatacacaatgatgctcctctggataaagtctgtttaattgcctgtgggttttctact
ggctatggctctgctctgaacacagccaaggttgaaccaggatccacatgtgctgtgttt
ggcctgggaggtgttggtctctctgtgattattggatgtaaagtagctggtgctgctaag
atcattggagtggatacaaacggtgataagtttgccaaagctaaagaagtgggagctact
gagtgcatcaatccaaatgattataaggaacctatccacaaagtgttggaaaagatgact
gatgggggcctagattattcttttgagtgtattggaaacaccagagtcatggcatctgct
ctactatccaccaaatttgcatgcggaacatcagttattgttggtgtagctccttcaaca
gcagaactgaatttggatcctatggtgatactcacaggacgcactttaaaaggatctctg
tttggaggatggaagagcaaagattgtgttccaaaactggttgctgattttatggaaaac
aagtttgaactggatgggctgatatctcacaagctaccacttcaaaaaatcaatgaagga
tttgatctcttgcacaaaggaacaagccttcgcaccgttttgtatttctga

DBGET integrated database retrieval system