KEGG   Xenopus tropicalis (western clawed frog): 496929Help
Entry
496929            CDS       T01011                                 

Gene name
eif3j, eIF-3-alpha, eif3s1
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    496929 (eif3j)
Translation factors [BR:xtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    496929 (eif3j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Ensembl: 
UniProt: 
Position
Un
AA seq 256 aa AA seqDB search
MAENDSWDADDFEPEVSNQKGAVSGPPPAGRDRWEGEDEEEDVKDNWDDEEEAEAATKQE
AQKTVEPKVSEKKKLLEKIREKEKLHKKRQEEVNQQEKEGTAPELSPEEQLAEKLRLKKL
QEDSDLELAKEAFGDNVTVTGIDAMNPSSREDFTEFGKLLKEKITQYERSLFYPGFLEVL
VREVCVSLEVDDLKKINNSLTVLCFEKQKQEKQQSKAKKKKKGVVPGGGLKANMKNDLED
YGGMDEGYGREYDDFM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacgacagctgggatgctgatgattttgagccagaagtttcaaatcagaag
ggtgctgtgtcaggcccaccaccggcaggaagagatcgttgggagggagaggacgaggag
gaggatgttaaggataactgggatgatgaagaggaggctgaggcggcaactaaacaagaa
gcacagaaaacggtagaaccaaaggtttctgaaaagaaaaaattactagaaaaaataaga
gaaaaagagaagttgcataaaaaaaggcaggaggaagtaaaccagcaggagaaggaagga
accgcaccagagttaagtccagaggaacagctggcagaaaagcttcgcctaaagaagtta
caggaggactccgacttagaattagcaaaggaggcttttggagacaatgttaccgttact
ggaatagatgccatgaatccgtcctcaagagaagactttacagaatttgggaagctcctc
aaagaaaagatcacccagtatgagagatcgttattttacccaggcttcctggaggtcctt
gtgcgggaagtgtgcgtctcattggaagtggatgacctgaagaaaatcaacaattctcta
acagtgttgtgctttgagaaacagaagcaagagaagcaacaaagtaaagccaaaaagaaa
aagaagggagttgttccgggaggaggactaaaagccaacatgaagaatgatctagaagat
tatgggggcatggatgagggctatggacgagagtatgacgatttcatgtga

DBGET integrated database retrieval system