KEGG   Xenopus tropicalis (western clawed frog): 496957Help
Entry
496957            CDS       T01011                                 

Gene name
chka, chkb
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    496957 (chka)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     496957 (chka)
    2.7.1.82  ethanolamine kinase
     496957 (chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 441 aa AA seqDB search
MKTKFPCGEELPSSLELLISTAGGLMTAQRGAVEPEVLGVTEKQEDAPNPKTRRKAYRWC
KEFLPGAWRVLEEERFHISVIRGGLSNMLYLCSLPEDEKSLSNEPRSVLLRLYGAILQMS
CNKGENQETQRQNFFQGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEEFIPSRKLET
SELSLPDLSAEIAEKMARFHGMNMPFNKEPKWLFGTMEKYLQQVLKIKFTRESHTRKLNK
ILAYDLSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSY
NYRGFDIGNHFCEWMYDYTFEKFPFFKATFSKYPTRRQQIHFVNSYLTEFLPGFENISNE
EQSKLENELLIEINRFALASHFFWGLWSIVQAKISSIEFGYMPMAVPKILEIGKKLAAWC
YLREPWTSVSQRRAMATQSLR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaagtttccgtgcggagaggagctgcccagctccctagaactgctcattagt
acagccggggggctcatgactgcgcagcggggcgcggtggagccggaagtgctcggtgtg
actgagaagcaagaggatgcgccgaaccccaagacgcggcgaaaggcttatcgctggtgt
aaggaattccttcccggggcgtggagggtcttggaggaggagcgcttccatatttctgtt
atacggggcggacttagcaatatgctttatctctgctcactgccagaagatgaaaaatct
ttgtctaatgagccaaggagtgtcctgcttaggttatatggcgccattctacagatgtct
tgtaacaaaggtgaaaatcaagagactcaaaggcagaattttttccaaggtgcagaggcc
atggtgatggaaagtgtaatgtttgccattttggctgagagatctctcggtcccaaactg
tatggaatttttccacaaggacgccttgaggagtttataccaagtaggaagctggagacc
agtgaactgagccttccagacttatctgctgaaatagctgaaaaaatggctcgttttcat
ggcatgaacatgccattcaacaaggaaccaaagtggctttttgggacaatggaaaagtat
ctgcagcaagttctgaagattaagttcacaagggaatcccacacccgcaagctgaataaa
attttagcttatgatctctccaaagaaatgaggagcctgagatgtctgctggaagccact
tcttcacctgttgtattttgtcacaatgactgccaggaaggtaacatccttctgttggat
ggaagggagaattcagaaaagcagaagcttatgctcattgactttgaatacagcagctac
aattacagaggatttgatatcgggaatcatttctgtgaatggatgtatgattatacattc
gaaaagtttcccttctttaaagcgaccttctccaaatacccaacaaggagacagcagatt
cactttgttaacagttacttgacagagttcctgcctgggtttgaaaacattagcaatgaa
gagcagagcaaattggaaaatgaattgttaattgaaattaacaggtttgctcttgcatct
cactttttctggggtctttggtccattgtgcaagctaaaatatcctcaattgaatttgga
tatatgcctatggcagtaccaaagatcctagagataggaaagaagctggcagcctggtgc
tatctaagggaaccttggaccagtgtttcacagcgaagagcaatggcaactcagagtctg
aggtaa

DBGET integrated database retrieval system